KEGG   Pseudomonas parafulva: NJ69_22025Help
Entry
NJ69_22025        CDS       T03520                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppv  Pseudomonas parafulva
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ppv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NJ69_22025
   00630 Glyoxylate and dicarboxylate metabolism
    NJ69_22025
   00640 Propanoate metabolism
    NJ69_22025
   00650 Butanoate metabolism
    NJ69_22025
  Lipid metabolism
   00071 Fatty acid degradation
    NJ69_22025
   00072 Synthesis and degradation of ketone bodies
    NJ69_22025
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NJ69_22025
   00310 Lysine degradation
    NJ69_22025
   00380 Tryptophan metabolism
    NJ69_22025
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NJ69_22025
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NJ69_22025
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NJ69_22025
Enzymes [BR:ppv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NJ69_22025
Exosome [BR:ppv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJ69_22025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5061405..5062682
Genome map
AA seq 425 aa AA seqDB search
MQSPRRVAILGGNRIPFARSNGAYATASNQAMLTATLEGLVERYRLHGLRLGEVVAGAVL
KHSRDLSLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIDSAIAGGVDT
TSDAPIAINEGLRRVLLEANRGRQLSERLKPFLKLRPSFLKPEFPRNGEPRTGLSMGEHC
ERMAQTWQIERAEQDALALLSHQHLAEAYDQGWHDDLLTPYLGLTRDNNLRPGLTAEQLA
KLKPVFDKGPKGTLTAGNSTPLTDGASLVLLGSEAWAEQQGLSVLAYLVDGEAAAVDFVK
GREGLLMAPVHAVPRLLARNGLSLQDFDYYEIHEAFAAQVLCTLKAWEDERYCREVLGLD
AALGAIDRSRLNVKGSSLAAGHPFAATGGRILANMAKLLAKAGKGRGLISICAASGQGVT
AIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcacctcgtcgcgttgcgatcctgggcggcaaccgtattccgttcgcccgctcc
aacggcgcctacgccaccgccagcaatcaggcgatgctcactgcgacgctggaaggtctg
gtggagcgctatcggctgcacgggctgcgcttgggcgaagtggtggccggcgcggtgctc
aagcactcgcgcgacctgagcctgacccgcgaatgcgtgctcggctcgcggctgtcgccg
cagacccccgcctacgacatccagcaggcctgtggcacggggctggaggctgcgctgctg
gtggcgaacaagatcgccctcgggcagatcgacagcgccatcgccggcggcgtggacacc
acctccgatgcaccgatcgcgatcaacgaggggctgcgccgggtgctgctggaggccaac
cgcggtcggcaactgagcgaacgtctgaagccgtttctcaagctgcggccgagctttctc
aagcccgagttcccgcgcaatggcgagccgcgcaccgggctgtcgatgggcgagcactgc
gagcgcatggcgcagacctggcagatcgagcgcgccgagcaggacgcactggcgctgctc
agtcaccagcacctggccgaggcctatgaccagggttggcacgatgacctgctcacgccc
tacctgggtctgacccgcgacaacaacctgcggccaggcctcaccgccgagcagttggcc
aagctcaagccggtgttcgacaaaggccccaagggcaccctgaccgctggcaactccacc
ccgctcaccgatggcgcctcgctggtgctgctgggcagcgaggcctgggccgagcagcag
ggattgtcggtgctggcctatctggtggacggcgaggcggccgccgtggacttcgtcaaa
ggtcgcgaaggtctgctcatggcgccggtgcatgcggtgccacgcctgttggcgcgcaat
ggcctgagcttgcaggacttcgactactacgaaatccacgaagccttcgccgcccaggtg
ctgtgcaccctcaaggcctgggaggacgagcgctactgtcgcgaggtgctggggctcgac
gcggcgctgggcgccatcgaccgcagccggctcaatgtcaagggcagctcgctggctgcc
ggtcatccgttcgccgccaccggtgggcggattctggcgaacatggccaagttgctggcc
aaggccggcaagggtcgcggactgatctcgatctgcgctgcgagcgggcagggggtgacg
gcgatcgtcgagcgctga

DBGET integrated database retrieval system