KEGG   Pseudomonas putida W619: PputW619_0100Help
Entry
PputW619_0100     CDS       T00675                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PputW619_0100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputW619_0100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PputW619_0100
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PputW619_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(107591..108400)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQNLAKTLQMVREFRVDNQATPIVLMGYYNPIHRFGVEKFVAEAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLADGVVVGSALVDKI
AQAKDADQAVADVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgctttgccgagctgaaagccgaaggccgctccgcactggta
accttcgtcaccgccggcgaccctggctacgatgcctcactgcagatcctcaagggcctg
ccggcggccggtgccgatgtgatcgaactgggcatgccgttcaccgacccgatggccgat
ggcgtagccatccagctggccacgctgcgtgcgctggaagcaggccagaacctggccaag
accctgcagatggtgcgtgaattccgcgtcgacaaccaggccacaccgatcgtgctgatg
ggttactacaacccgatccaccgctttggtgtagagaaattcgtcgcagaagccaaagaa
gcgggtgtcgatggcctgatcatcgtcgacctgccgccggagcacgatgctgagctcgcc
accccggcccaggccgctggcatcgacttcattcgcctgaccaccccaaccaccgacgat
gcgcgcctgccacgggtgctggagcgcagctccgggttcgtctattacgtgtcggtggca
ggcgtgaccggcgccggctcggcaaccaccgagcacgtgaccgaagccatcgcccgcctg
cgtcggcataccgatctgccgatcagcgttggcttcggcattcgtacaccagagcaggcc
gcagcgattgcgcgcctggctgatggcgtggtggtggggtcggcgctggtcgacaagatc
gcccaggccaaggacgccgatcaggccgttgccgatgtattgagcctgtgctctgcgctg
gctgaaggtgtgcgcggcgctcgacgctga

DBGET integrated database retrieval system