KEGG   Pseudomonas putida W619: PputW619_0101Help
Entry
PputW619_0101     CDS       T00675                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppw00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(108397..109614)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLIACVG
GGSNAMGLFHEFLEDESVKIIGVEAGGHGVNTGKHAASLNGGVPGVLHGNRTYLLQDDDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALETS
HALAEAIKRAPNLPKDHLMVICLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaacggcctgttcggctcgttcggt
ggccgctatgtggccgaaaccctgatgccgctggtgctggatctggcccgcgaatacgaa
gccgccaaggccgaccccaagttcctcgaagaactggcctacttccagcgcgactacatc
ggccgccccaacccgctgtatttcgccgagcgcctgaccgagcattgcggcggcgccaag
attttcttcaaacgtgaagagctcaaccacaccggcgcgcacaaggtgaacaactgcatc
ggccaagtgctgctggccaagcgcatgggcaaaaaacgcctgatcgccgaaaccggcgcc
ggcatgcacggcgtggccactgccaccgtcgccgcacgcttcgggctaccctgcgtgatc
tacatgggtgcaaccgacatcgagcgccagcaggccaacgtgttccgcatgaagctgctg
ggcgccgagatcgtcccggttactgccggcaccggcacactgaaagacgcaatgaacgaa
gccctgcgcgactgggtcaccaacgtcgacgacaccttctacctgatcggtaccgtggcc
ggcccgcacccgtaccctgcaatggtccgcgatttccagtcgatcatcggcaaagagacc
cgcgcccagttgcaagaaaaggaaggtcgcctgcccgacagcctgattgcctgtgttggc
ggtggctccaatgccatgggcctgttccacgaattcctcgaagacgagagcgtcaagatc
attggtgtggaagccggtggccatggcgtgaacaccggcaagcatgcggccagcctcaac
ggcggcgtacccggcgtgctgcacggcaaccgtacctacctgctacaggacgatgacggc
cagatcactgacgcccactcgatttcggccggcctcgactacccgggcatcggccccgag
catgcctacctgcatgaagtgaagcgtgtggagtacgtcagcatcactgacgatgaggcc
ctcgacgcgttccacgccacctgccgcctggaaggcatcatccctgccctggaaacctcg
cacgccctggcagaagcgatcaagcgcgcgccgaacctgcccaaggaccacctgatggtc
atctgcctgtcaggccgtggcgacaaagacatgcaaaccgtgatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system