KEGG   Pseudomonas putida W619: PputW619_0101Help
Entry
PputW619_0101     CDS       T00675                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputW619_0101
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PputW619_0101
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PputW619_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(108397..109614)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLIACVG
GGSNAMGLFHEFLEDESVKIIGVEAGGHGVNTGKHAASLNGGVPGVLHGNRTYLLQDDDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALETS
HALAEAIKRAPNLPKDHLMVICLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaacggcctgttcggctcgttcggt
ggccgctatgtggccgaaaccctgatgccgctggtgctggatctggcccgcgaatacgaa
gccgccaaggccgaccccaagttcctcgaagaactggcctacttccagcgcgactacatc
ggccgccccaacccgctgtatttcgccgagcgcctgaccgagcattgcggcggcgccaag
attttcttcaaacgtgaagagctcaaccacaccggcgcgcacaaggtgaacaactgcatc
ggccaagtgctgctggccaagcgcatgggcaaaaaacgcctgatcgccgaaaccggcgcc
ggcatgcacggcgtggccactgccaccgtcgccgcacgcttcgggctaccctgcgtgatc
tacatgggtgcaaccgacatcgagcgccagcaggccaacgtgttccgcatgaagctgctg
ggcgccgagatcgtcccggttactgccggcaccggcacactgaaagacgcaatgaacgaa
gccctgcgcgactgggtcaccaacgtcgacgacaccttctacctgatcggtaccgtggcc
ggcccgcacccgtaccctgcaatggtccgcgatttccagtcgatcatcggcaaagagacc
cgcgcccagttgcaagaaaaggaaggtcgcctgcccgacagcctgattgcctgtgttggc
ggtggctccaatgccatgggcctgttccacgaattcctcgaagacgagagcgtcaagatc
attggtgtggaagccggtggccatggcgtgaacaccggcaagcatgcggccagcctcaac
ggcggcgtacccggcgtgctgcacggcaaccgtacctacctgctacaggacgatgacggc
cagatcactgacgcccactcgatttcggccggcctcgactacccgggcatcggccccgag
catgcctacctgcatgaagtgaagcgtgtggagtacgtcagcatcactgacgatgaggcc
ctcgacgcgttccacgccacctgccgcctggaaggcatcatccctgccctggaaacctcg
cacgccctggcagaagcgatcaagcgcgcgccgaacctgcccaaggaccacctgatggtc
atctgcctgtcaggccgtggcgacaaagacatgcaaaccgtgatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system