KEGG   Pseudomonas putida W619: PputW619_0142Help
Entry
PputW619_0142     CDS       T00675                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(145581..146477)
Genome map
AA seq 298 aa AA seqDB search
MATFQVVTEQHGELNCWRITSDRAELLIAQQGAQILSYQHIGEPPLLWLSDQAMFRQGKS
VRAGVPVCWPWFGNLQRNPESVQGMYRGTQAPAHGLARTRDWQLLGIEEAASALRIEFEL
PEAQGDLPEWPHDVELKLLIVMGDALELTLTSRNRGNTPVTISQALHSYFAVSDVRQARV
EGVDGLGYIETLADWEQRQQQGALTFTGETDRIYLNTPAQLGIVDPHWNRRITLSSSGSR
SAVIWNPWTDRAQELPDMADDGWQRMLCIETANVWDDVVELKPGAFHSLQVAIGSEAL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttccaggttgtaaccgagcaacacggcgaactcaactgctggcgtatcacc
agcgaccgtgccgaactactgatcgcccagcagggcgcgcagatcctcagctaccagcac
attggcgagccgccgctgctgtggctgagtgaccaggccatgttccgtcagggtaagtcg
gtgcgcgcaggtgtgccggtgtgctggccgtggttcggtaacctgcagcgcaaccccgaa
tccgtccagggcatgtaccgtggcacacaggctcccgcccatgggttggcccgcacacgg
gactggcaactgctgggcatcgaagaagcagccagcgcgctgcgcatcgaattcgaactg
ccggaggcccagggcgacctgccggagtggccacatgatgtggagctgaagctgctgatc
gtcatgggtgatgcgcttgaactgaccctcaccagccgtaacaggggcaatacccctgtc
accatcagccaggccctgcacagctattttgccgtcagcgatgtgcgtcaggcgcgggtc
gagggtgtcgacgggctgggctacatcgagactctggctgactgggaacagcgccagcag
cagggtgcgctgacgttcaccggtgagaccgatcgcatctacctgaatacgcctgcgcaa
ctgggcattgtcgacccgcactggaaccggcgcattaccctgagcagcagcggttcacgt
tcagcggtgatctggaacccatggaccgacagagcccaggaattgcctgacatggccgat
gatggctggcagcgaatgctgtgcatcgagacggcgaatgtctgggacgatgtggtggag
ttgaagcctggggcgttccattcgctgcaagtggcaattggcagcgaagcgctttga

DBGET integrated database retrieval system