KEGG   Pseudomonas putida W619: PputW619_0333Help
Entry
PputW619_0333     CDS       T00675                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ppw  Pseudomonas putida W619
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PputW619_0333
   00670 One carbon pool by folate
    PputW619_0333
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PputW619_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
350234..350749
Genome map
AA seq 171 aa AA seqDB search
MTTSLPLSLIAALAENRVIGIDNTMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRPLP
GRLNIVVSRQTGLALAGAEVFASLEDALERAEQWAREQGVDELMLIGGAQLYAQALEKGL
VSRMYLTRVELSPQGDAWFPEFDKAQWQLASSEPQTEADKPAYHFEVWDKS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactacttcactccccctcagcctgattgcggccctcgccgagaaccgcgtcatcggc
atcgacaacaccatgccctggcacttgccgggggatttcaaatacttcaaggccaccacc
ttgggcaagccgatcatcatgggccgcaagacctgggattcgctgggcaggccgctgccg
gggcgcctgaacatcgtggtcagtcgtcagacgggcttggcgctggccggcgccgaagtg
ttcgcttcgctcgaagatgcgctggagcgcgctgagcaatgggcgcgtgagcagggtgtt
gacgaactgatgctgatcggcggggcgcagttgtacgctcaggccctggaaaagggcttg
gtgagccgtatgtatctgacccgggtggagctttcgccgcaaggggatgcgtggttcccg
gagttcgacaaggcgcagtggcagctggcatcgagtgagccgcagacagaggcggacaag
cctgcgtatcacttcgaggtgtgggacaagtcttga

DBGET integrated database retrieval system