KEGG   Pseudomonas putida W619: PputW619_0521Help
Entry
PputW619_0521     CDS       T00675                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00250  Alanine, aspartate and glutamate metabolism
ppw00330  Arginine and proline metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputW619_0521
   00330 Arginine and proline metabolism
    PputW619_0521
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PputW619_0521
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PputW619_0521
Transcription factors [BR:ppw03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PputW619_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg RHH_1
Motif
Other DBs
NCBI-ProteinID: ACA71026
UniProt: B1J320
Structure
PDB: 

Jmol
Position
complement(572969..576922)
Genome map
AA seq 1317 aa AA seqDB search
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLEGGATLTELNGQANSP
ADDAGEVQPDHAHQCFLEFAESILPQSVLRSAITAAYRRPEQEVVPMLLEQARLSAPLAE
ATNKMAAGIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD
ALIRDKISSGNWHPHLGNSPSLFVNAATWGLLLTGKLVSTHNEAGLTTSLTRIIGKSGEP
MIRKGVDMAMRLMGEQFVTGETIAEALANASRFESKGFRYSYDMLGEAALTEHDAQKYLA
SYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMEELYPRLLSLTLLAKQ
YDIGLNIDAEEADRLELSLDLLERLCFEPSLAGWNGIGFVIQAYQKRCPYVIDYVIDLAK
RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYVACARKLLAVPEAIYP
QFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP
VGTHETLLAYLVRRLLENGANTSFVNRIADHSISIQELVADPVASIERMATQEGSIGLPH
PRIPLPRDLYGSERANSAGIDMANEHRLASLSCAMLATAHNDWKATPLLACAASESAATA
VLNPADHRDVVGHVQEATVADVDNAIQCALNAAPIWQATPPAERAAILERTADLMEAEIQ
PLMGLLIREAGKTFANAIAEVREAVDFLRYYAVQARNDFSNDAHRPLGPVVCISPWNFPL
AIFTGQVAAALAAGNPVLAKPAEQTPMIAAQAVRLLLEAGIPEGVLQLLPGRGETVGAGL
VGDERVKGVMFTGSTEVARLLQRNVAGRLDNQGRPIPLIAETGGQNAMIVDSSALTEQVV
IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAESRLGNPDRLAVDIGPVIDA
EAKAGIEKHIQGMREKGRPVYQVAIADAAETKRGTFVMPTLIELESFDELKREIFGPVLH
VVRYNRRNLDQLIEQINNSGYGLTLGVHTRIDETIAKVVENANAGNMYVNRNIVGAVVGV
QPFGGEGLSGTGPKAGGPLYLYRLLSTRPADAIGRHFQQQDGEGKPDRTLHEQLVKPLHG
LKAWAQSNQLADLAALCDQFASQSQSGIARLLPGPTGERNSYTILPREHVLCLADNEADL
LAQLAAVLAVGSSAVWADSEPGKALRARLPRELQAKVKLVADWNKDEVAFDAVIHHGDSD
QLRSVCQQVAKRAGAIVGVHGLSSGDHQIALERLVIERAVSVNTAAAGGNASLMTIG
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaccacccttggggtcaaactcgatgaccctacccgtgagcgactcaaggca
gctgcgcagtccatcgaccgcacgccgcactggttgatcaagcaagcaatcttcaattac
ctggagaagctcgagggtggcgccaccctgaccgaactcaacggtcaggccaacagcccg
gccgatgatgccggtgaagtacagcccgaccatgcgcaccagtgcttcctggagttcgct
gagagcatcctgccccagtcggtgctgcgctcggccattacagccgcctatcgccgcccc
gagcaggaagtggtgccgatgctgctggaacaggcgcgcctgagcgcacccctggccgag
gcgaccaacaagatggccgccggcatcgccgagaagctgcgcaaccagaagagcgccggt
ggccgcgccggcatcgtccagggcctgctgcaggagttctcgctgtcgtcccaggaaggc
gtggcgctgatgtgcctggccgaagccctgctgcgtattcccgacaaaggcacccgtgac
gcgctgatccgcgacaagatcagcagcggcaactggcacccgcacttgggcaacagcccg
tcgctgttcgtcaacgcggccacctggggcctgttgctgaccggtaaactggtttccacc
cacaacgaagccggcctcaccacctcgctcacccgcatcatcggcaagagcggcgaaccg
atgatccgcaagggcgtcgacatggccatgcgcctgatgggcgaacagtttgtcaccggc
gagaccatcgccgaagcactggccaacgccagccgcttcgagtccaagggcttccgctac
tcctacgacatgctcggcgaagccgcgctgaccgagcacgatgcgcagaaatacctggcg
tcctatgagcaggcgatccactcgatcggcaaggcctcccacggccgcggcatctatgaa
ggcccgggcatctcgatcaagctctcggcactgcacccacgctacagccgcgctcaatac
gagcgggtgatggaagagttgtacccgcgcctgctgtcgctgaccctgctggccaagcag
tatgacatcggcctgaacatcgacgctgaagaggccgaccgcctggagctgtcgctcgac
ctgctcgagcgcctgtgcttcgagccatcactggccggctggaacggcatcggctttgtc
atccaggcttaccagaagcgctgcccatatgtgatcgactacgtcatcgacctggccaaa
cgcagccgtcaccgcctgatgatccgcctggtgaaaggcgcctactgggacagcgaaatc
aagcgcgctcaggttgagggtctggaaggctacccggtctacacccgcaaggtgtacacc
gacgtttcctacgtcgcttgcgcccgcaagttgctggcggtaccggaagccatctacccg
cagttcgccacccacaacgcccacaccctgtcggccatctaccacatcgccggccagaac
tattacccggggcagtacgagttccagtgcctgcacggcatgggcgaaccgctgtacgag
caggttgtaggcaaagtctcggaaggcaagcttaaccgcccgtgccgcgtctacgcgccg
gtcggcacccacgaaaccctgctggcctacctggtgcgccgcctgctggaaaacggcgcg
aacacctcgttcgtcaaccgtatcgccgaccactcgatctccatccaggaactggtcgcc
gacccggtcgccagtatcgagcgcatggccacccaggaaggcagcatcggcctgccgcac
ccgcgcatcccgttaccgcgtgacctgtatggcagtgagcgggccaactcggccggtatc
gacatggccaacgaacaccgcctggcgtcgttgtcctgcgccatgctggccacagcccac
aatgactggaaagccaccccattgctggcctgcgccgccagcgaaagcgctgccacagcg
gtactgaacccggcagatcatcgcgacgtggtcggccacgtgcaggaagccaccgttgcc
gacgtcgacaacgccatccagtgcgcgctcaatgccgcaccgatctggcaggccactcca
cccgctgagcgcgcagcgatcctggagcgcaccgctgacctgatggaagccgagatccag
ccgctgatgggcctgctcatccgcgaggccggcaaaaccttcgccaacgccattgccgaa
gtgcgcgaggccgttgacttcctgcgctactacgccgtgcaggcgcgcaacgatttcagc
aatgacgcccaccgcccattgggcccggtggtgtgcatcagcccgtggaacttcccgctg
gccatcttcaccggccaggtagccgcagccttggctgccggtaaccctgtgctggccaaa
cccgccgaacagaccccgatgatcgcagcccaggctgtgcgcctgctgctcgaagccggc
attccggaaggcgtgctgcaactgctgccagggcgcggcgaaaccgttggtgccggcctg
gtcggcgacgaacgcgtcaagggcgtgatgttcaccggttccaccgaagtggcgcgcctg
ctgcaacgcaacgtcgccgggcgcctggacaaccagggccgtccgatcccgctgatcgcc
gaaaccggtggccagaacgcgatgatcgtcgattcctcggcgctgaccgagcaggtggtg
atcgacgtggtgtcctcggccttcgacagtgctggccagcgctgctcggccctgcgcgtg
ctgtgcctgcaggaagactcggctgaccgcgtgatcgagatgctcaaaggtgccatggcc
gaaagtcgcctgggcaaccctgaccgcctggccgtggacattggcccggtaatcgatgcc
gaagccaaggccggtatcgagaagcacatccagggcatgcgcgaaaaaggccgccctgtt
tatcaggtcgccatcgccgatgctgctgaaaccaagcgtggcaccttcgtgatgccgacc
ctgatcgagctggagagcttcgatgagctcaagcgcgagatcttcggcccggtactgcac
gtggtgcgttacaaccgccgcaacctcgaccagttgatcgagcagatcaacaactccggc
tatggcctgaccctcggcgtgcatacccgcatcgacgagaccatcgccaaggtggtggag
aacgccaacgccggcaacatgtacgtcaaccgcaacatcgttggtgcggtggtgggcgtg
cagccgttcggtggtgaaggcctgtccggtaccggcccgaaagcgggtggcccgctgtac
ctgtaccgcctgctgtcgacccgcccggcagacgccattggccgtcacttccagcagcag
gatggcgaaggcaaaccggaccgcaccctgcacgaacagctggtcaagccgctgcacggc
ctgaaggcctgggcccagagcaaccagctggccgacttggctgcgctgtgcgaccagttc
gccagccagtcgcagagcggcatcgcccgcctgctgccaggcccgaccggcgagcgcaac
agctacaccatcctgccacgcgagcacgtgctgtgcctggccgacaacgaggctgacctg
ctggcgcagttggccgcagtactggccgtcggcagctcggcggtgtgggcagacagcgag
cctggcaaagccctgcgtgcccgcctgccgcgtgagctgcaggccaaggtcaagctggtg
gcggactggaacaaggatgaagtggcgttcgacgccgtgattcaccatggcgattcggac
cagctgcgcagcgtgtgccagcaggtggccaagcgtgctggtgcgatcgtcggtgtgcac
gggctgtccagcggggatcaccagattgcgctggagcggctggtgattgagcgggcggtg
agtgtgaacaccgcggcggcgggggggaatgccagcttgatgaccattggctga

DBGET integrated database retrieval system