KEGG   Pseudomonas putida W619: PputW619_0521Help
Entry
PputW619_0521     CDS       T00675                                 

Gene name
putA
Definition
trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
Orthology
K13821  
proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppw  Pseudomonas putida W619
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputW619_0521 (putA)
   00330 Arginine and proline metabolism
    PputW619_0521 (putA)
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PputW619_0521 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PputW619_0521 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(572969..576922)
Genome map
AA seq 1317 aa AA seqDB search
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLEGGATLTELNGQANSP
ADDAGEVQPDHAHQCFLEFAESILPQSVLRSAITAAYRRPEQEVVPMLLEQARLSAPLAE
ATNKMAAGIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD
ALIRDKISSGNWHPHLGNSPSLFVNAATWGLLLTGKLVSTHNEAGLTTSLTRIIGKSGEP
MIRKGVDMAMRLMGEQFVTGETIAEALANASRFESKGFRYSYDMLGEAALTEHDAQKYLA
SYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMEELYPRLLSLTLLAKQ
YDIGLNIDAEEADRLELSLDLLERLCFEPSLAGWNGIGFVIQAYQKRCPYVIDYVIDLAK
RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYVACARKLLAVPEAIYP
QFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP
VGTHETLLAYLVRRLLENGANTSFVNRIADHSISIQELVADPVASIERMATQEGSIGLPH
PRIPLPRDLYGSERANSAGIDMANEHRLASLSCAMLATAHNDWKATPLLACAASESAATA
VLNPADHRDVVGHVQEATVADVDNAIQCALNAAPIWQATPPAERAAILERTADLMEAEIQ
PLMGLLIREAGKTFANAIAEVREAVDFLRYYAVQARNDFSNDAHRPLGPVVCISPWNFPL
AIFTGQVAAALAAGNPVLAKPAEQTPMIAAQAVRLLLEAGIPEGVLQLLPGRGETVGAGL
VGDERVKGVMFTGSTEVARLLQRNVAGRLDNQGRPIPLIAETGGQNAMIVDSSALTEQVV
IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAESRLGNPDRLAVDIGPVIDA
EAKAGIEKHIQGMREKGRPVYQVAIADAAETKRGTFVMPTLIELESFDELKREIFGPVLH
VVRYNRRNLDQLIEQINNSGYGLTLGVHTRIDETIAKVVENANAGNMYVNRNIVGAVVGV
QPFGGEGLSGTGPKAGGPLYLYRLLSTRPADAIGRHFQQQDGEGKPDRTLHEQLVKPLHG
LKAWAQSNQLADLAALCDQFASQSQSGIARLLPGPTGERNSYTILPREHVLCLADNEADL
LAQLAAVLAVGSSAVWADSEPGKALRARLPRELQAKVKLVADWNKDEVAFDAVIHHGDSD
QLRSVCQQVAKRAGAIVGVHGLSSGDHQIALERLVIERAVSVNTAAAGGNASLMTIG
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaccacccttggggtcaaactcgatgaccctacccgtgagcgactcaaggca
gctgcgcagtccatcgaccgcacgccgcactggttgatcaagcaagcaatcttcaattac
ctggagaagctcgagggtggcgccaccctgaccgaactcaacggtcaggccaacagcccg
gccgatgatgccggtgaagtacagcccgaccatgcgcaccagtgcttcctggagttcgct
gagagcatcctgccccagtcggtgctgcgctcggccattacagccgcctatcgccgcccc
gagcaggaagtggtgccgatgctgctggaacaggcgcgcctgagcgcacccctggccgag
gcgaccaacaagatggccgccggcatcgccgagaagctgcgcaaccagaagagcgccggt
ggccgcgccggcatcgtccagggcctgctgcaggagttctcgctgtcgtcccaggaaggc
gtggcgctgatgtgcctggccgaagccctgctgcgtattcccgacaaaggcacccgtgac
gcgctgatccgcgacaagatcagcagcggcaactggcacccgcacttgggcaacagcccg
tcgctgttcgtcaacgcggccacctggggcctgttgctgaccggtaaactggtttccacc
cacaacgaagccggcctcaccacctcgctcacccgcatcatcggcaagagcggcgaaccg
atgatccgcaagggcgtcgacatggccatgcgcctgatgggcgaacagtttgtcaccggc
gagaccatcgccgaagcactggccaacgccagccgcttcgagtccaagggcttccgctac
tcctacgacatgctcggcgaagccgcgctgaccgagcacgatgcgcagaaatacctggcg
tcctatgagcaggcgatccactcgatcggcaaggcctcccacggccgcggcatctatgaa
ggcccgggcatctcgatcaagctctcggcactgcacccacgctacagccgcgctcaatac
gagcgggtgatggaagagttgtacccgcgcctgctgtcgctgaccctgctggccaagcag
tatgacatcggcctgaacatcgacgctgaagaggccgaccgcctggagctgtcgctcgac
ctgctcgagcgcctgtgcttcgagccatcactggccggctggaacggcatcggctttgtc
atccaggcttaccagaagcgctgcccatatgtgatcgactacgtcatcgacctggccaaa
cgcagccgtcaccgcctgatgatccgcctggtgaaaggcgcctactgggacagcgaaatc
aagcgcgctcaggttgagggtctggaaggctacccggtctacacccgcaaggtgtacacc
gacgtttcctacgtcgcttgcgcccgcaagttgctggcggtaccggaagccatctacccg
cagttcgccacccacaacgcccacaccctgtcggccatctaccacatcgccggccagaac
tattacccggggcagtacgagttccagtgcctgcacggcatgggcgaaccgctgtacgag
caggttgtaggcaaagtctcggaaggcaagcttaaccgcccgtgccgcgtctacgcgccg
gtcggcacccacgaaaccctgctggcctacctggtgcgccgcctgctggaaaacggcgcg
aacacctcgttcgtcaaccgtatcgccgaccactcgatctccatccaggaactggtcgcc
gacccggtcgccagtatcgagcgcatggccacccaggaaggcagcatcggcctgccgcac
ccgcgcatcccgttaccgcgtgacctgtatggcagtgagcgggccaactcggccggtatc
gacatggccaacgaacaccgcctggcgtcgttgtcctgcgccatgctggccacagcccac
aatgactggaaagccaccccattgctggcctgcgccgccagcgaaagcgctgccacagcg
gtactgaacccggcagatcatcgcgacgtggtcggccacgtgcaggaagccaccgttgcc
gacgtcgacaacgccatccagtgcgcgctcaatgccgcaccgatctggcaggccactcca
cccgctgagcgcgcagcgatcctggagcgcaccgctgacctgatggaagccgagatccag
ccgctgatgggcctgctcatccgcgaggccggcaaaaccttcgccaacgccattgccgaa
gtgcgcgaggccgttgacttcctgcgctactacgccgtgcaggcgcgcaacgatttcagc
aatgacgcccaccgcccattgggcccggtggtgtgcatcagcccgtggaacttcccgctg
gccatcttcaccggccaggtagccgcagccttggctgccggtaaccctgtgctggccaaa
cccgccgaacagaccccgatgatcgcagcccaggctgtgcgcctgctgctcgaagccggc
attccggaaggcgtgctgcaactgctgccagggcgcggcgaaaccgttggtgccggcctg
gtcggcgacgaacgcgtcaagggcgtgatgttcaccggttccaccgaagtggcgcgcctg
ctgcaacgcaacgtcgccgggcgcctggacaaccagggccgtccgatcccgctgatcgcc
gaaaccggtggccagaacgcgatgatcgtcgattcctcggcgctgaccgagcaggtggtg
atcgacgtggtgtcctcggccttcgacagtgctggccagcgctgctcggccctgcgcgtg
ctgtgcctgcaggaagactcggctgaccgcgtgatcgagatgctcaaaggtgccatggcc
gaaagtcgcctgggcaaccctgaccgcctggccgtggacattggcccggtaatcgatgcc
gaagccaaggccggtatcgagaagcacatccagggcatgcgcgaaaaaggccgccctgtt
tatcaggtcgccatcgccgatgctgctgaaaccaagcgtggcaccttcgtgatgccgacc
ctgatcgagctggagagcttcgatgagctcaagcgcgagatcttcggcccggtactgcac
gtggtgcgttacaaccgccgcaacctcgaccagttgatcgagcagatcaacaactccggc
tatggcctgaccctcggcgtgcatacccgcatcgacgagaccatcgccaaggtggtggag
aacgccaacgccggcaacatgtacgtcaaccgcaacatcgttggtgcggtggtgggcgtg
cagccgttcggtggtgaaggcctgtccggtaccggcccgaaagcgggtggcccgctgtac
ctgtaccgcctgctgtcgacccgcccggcagacgccattggccgtcacttccagcagcag
gatggcgaaggcaaaccggaccgcaccctgcacgaacagctggtcaagccgctgcacggc
ctgaaggcctgggcccagagcaaccagctggccgacttggctgcgctgtgcgaccagttc
gccagccagtcgcagagcggcatcgcccgcctgctgccaggcccgaccggcgagcgcaac
agctacaccatcctgccacgcgagcacgtgctgtgcctggccgacaacgaggctgacctg
ctggcgcagttggccgcagtactggccgtcggcagctcggcggtgtgggcagacagcgag
cctggcaaagccctgcgtgcccgcctgccgcgtgagctgcaggccaaggtcaagctggtg
gcggactggaacaaggatgaagtggcgttcgacgccgtgattcaccatggcgattcggac
cagctgcgcagcgtgtgccagcaggtggccaagcgtgctggtgcgatcgtcggtgtgcac
gggctgtccagcggggatcaccagattgcgctggagcggctggtgattgagcgggcggtg
agtgtgaacaccgcggcggcgggggggaatgccagcttgatgaccattggctga

DBGET integrated database retrieval system