KEGG   Pseudomonas putida W619: PputW619_0715Help
Entry
PputW619_0715     CDS       T00675                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ppw  Pseudomonas putida W619
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PputW619_0715
Enzymes [BR:ppw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PputW619_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
788056..788907
Genome map
AA seq 283 aa AA seqDB search
MSSKLYPTRLPCGNRVLDLSRTHVMGILNITPDSFSDGGRFSQRDEALRHAEAMVAAGAT
LIDIGGESTRPGARAVSVTEELERVAPMVEAINSRLDVVISVDTSTPAVIRESARLGAGL
INDVRALERDGALDAAADTGLPVCLMHMRGEPGNMQDDPHYEDVTADVTRYLEQRMAACA
AAGIGAERIILDPGFGFAKTLAHNLSLFKHMEALYSLGRPLLVGVSRKSMIGLTLDRPVG
ERLYGSLALAALAMTKGASILRVHDVAETADVVRMIAAVQNAE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaagctgtacccgacccggttgccttgcggcaaccgggttcttgatttgtcc
cgtacccatgtcatgggtatcctcaacatcacccccgattctttctctgatggcgggcgc
ttcagtcagcgcgacgaggctctgcgtcatgcagaagccatggttgcggcgggcgcaacg
ctgatcgacatcggcggcgagtcgactcgtccgggcgcccgtgcggtctcggtgaccgag
gagctcgagcgtgtggcgccgatggtcgaagcgatcaatagtcgccttgatgtggtcatt
tcggtcgatacctccacgcctgccgtcatacgtgagtcggctcgcctcggtgctggcctg
atcaacgacgtgcgtgcgctggagcgcgatggcgccctcgacgccgctgcagataccggg
ctgccggtgtgcctgatgcacatgcgcggtgagccggggaacatgcaggacgacccgcat
tacgaggatgtgaccgccgatgtaacgcgctatcttgaacagcggatggcggcttgcgca
gcagcgggtatcggtgccgaacgcatcatcctcgacccgggtttcgggttcgccaagaca
ctggcgcataacctgagcctgttcaagcatatggaagcactttacagtctcgggcgcccg
ttgctggtgggtgtttcacgcaagagcatgatcggcctgacgctggatcgtccggttggt
gagcggctgtacggcagcctggcgctggcggctttggccatgaccaagggtgccagcatt
ctgcgcgtccatgatgtggccgagaccgccgatgtggtacgcatgattgctgcggtacag
aacgccgaataa

DBGET integrated database retrieval system