KEGG   Pseudomonas putida W619: PputW619_0731Help
Entry
PputW619_0731     CDS       T00675                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00010  Glycolysis / Gluconeogenesis
ppw00620  Pyruvate metabolism
ppw00640  Propanoate metabolism
ppw00680  Methane metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_0731
   00620 Pyruvate metabolism
    PputW619_0731
   00640 Propanoate metabolism
    PputW619_0731
  Energy metabolism
   00680 Methane metabolism
    PputW619_0731
Enzymes [BR:ppw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PputW619_0731
Lipid biosynthesis proteins [BR:ppw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PputW619_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N RhoGAP-FF1
Motif
Other DBs
NCBI-ProteinID: ACA71236
UniProt: B1J2B9
Position
complement(806199..808133)
Genome map
AA seq 644 aa AA seqDB search
MFDIRDYPQALAVSQAASLSTDDYSRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
KTGEARWFAGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPADSKAITYQELHRQVCRLAN
ALKARGVKKGDRVCIYMPMIPEAAYAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKAMASCPDVSSVLVVRRTGTDVAWSEGRDLWYDQATENA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTAGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAVSLMFEGVPNYPDTSRFWQVVDKHKVNIFYTAPTALRAL
MREGSGPLQGTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQRLKPGCATQPMFGVQPVLLDDKGKLIEGPGAGLLAIKASWPGQIRSVYGDHQRM
IDTYFKPMPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHESVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTADDALKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELDTLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcgactacccccaggccctggccgtcagccaggccgccagcctttct
accgacgactacagccgcctctaccgccagtcggtcgaagaccccgacaccttctgggcc
gaacaggccaaacgcctggactggatcaaaccgtggtccagcgtacagcaatgcgacctt
aagaccggcgaagcccgctggttcgcaggtgcccagctgaacgtcagctacaactgcatc
gatcgccatctggcccagcgcggcgagcagaccgcactgctgtgggaaggcgacgaccct
gcggactccaaggccatcacctaccaagagttgcaccgccaggtctgtcgcttggccaat
gcactcaaggcacgtggcgtgaagaaaggcgaccgggtatgcatctatatgccgatgatt
cccgaagctgcctacgccatgcttgcctgcacgcggatcggcgcgatccactcggtggtg
ttcggcggcttctccccggatgcgttgcgcgaccgcattctcgatgctgactgccgcacc
gtgatcaccgccgatgagggtgtacgcggcggcaaacgcatcccgctcaagcagaatgtc
gacaaggcaatggccagttgcccggacgtcagcagcgtattggtggtgcgccgcaccggt
accgatgtggcctggagcgagggccgcgacctctggtatgaccaggcaacggaaaacgcc
ggcgacgactgcccacctgaacccatggaggccgaagacccgctgttcatcctttatacc
tccggcagcaccggcaagcccaagggcgtgctgcacaccactgccggttacctgctgcag
gccaccatgaccttcaaggtagtgttcgactaccgtgacggcgaggtgttctggtgcacc
gccgacgtgggctgggtcaccggccacagttacatcgtctatggtccgctggccaacggc
gcggtttcactgatgttcgagggcgttcccaactacccggacacctcgcggttctggcag
gtggtagacaagcacaaggtcaatatcttctacaccgcgcccaccgcactgcgggcactg
atgcgtgaaggctccggcccgttgcaggggacgtcacgcaagagcctgcgcctgctgggc
agcgtcggcgagccaatcaacccagaggcgtgggaatggtacttcgaggaagtcggccaa
aaacgctgccccatcgttgacacctggtggcagaccgaaaccggcggcatcatgctcacc
ccgctgcccggcacgcagaggctcaagccagggtgtgcgacacaacccatgttcggcgtg
caaccggtgctgctggatgacaaaggcaagctgatcgaagggcccggcgccggcttgctg
gcgataaaggccagttggccggggcagatccgcagcgtctacggcgaccaccaacgcatg
atcgacacctacttcaaacctatgcccggctattatttcaccggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccggccgcatcgatgatgtgatcaacgtttccggc
caccgcatcggcaccgctgaagtggaaagcgcactggtattgcacgaaagcgtcgccgag
gccgcagtggtcggttacccccatgacctcaagggtcagggtgtgtatgccttcgtgacg
accatgaatggcgtaacagcggacgatgccctgaaggccgaactgttggcactggtcagc
aaggaaatcggcagcttcgccaaacccgagctgatccagtgggcgccggccttgcccaag
acccgctcgggcaagatcatgcggcgtatactgcgcaagatcgcctgcaacgaactcgac
accctgggcgatacctcgaccctggcagacccaagcgtggtgcaggggttgatcgacaaa
cgcctcaaccaatag

DBGET integrated database retrieval system