KEGG   Pseudomonas putida W619: PputW619_0735Help
Entry
PputW619_0735     CDS       T00675                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppw  Pseudomonas putida W619
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PputW619_0735
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PputW619_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(811995..812474)
Genome map
AA seq 159 aa AA seqDB search
MTTRAYIGLGSNLDAPAEQLGNALQALDRVASTRLVAASALYTSDSLLPGQPRYTNAVAA
LDTSLAPLDLLDALQAIENEQGRVRKERWGPRTLDLDILLFGDHVIDVPRLQVPHYHMHA
RPFVLYPLAELVADDFHLADGRPLAQLLQACPFVGLERL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactcgcgcctacatcggccttggcagcaacctggatgcgcctgccgagcaactg
ggcaacgccttgcaggcgctggatcgggtcgcgagcacccgcctggtggcggcctctgcc
ctgtacaccagcgactccctgctgcctggccagccgcgttacaccaacgccgtcgccgcc
ctggatacctcactcgcccccctggacctgctggacgccctgcaagccatcgagaatgaa
cagggccgtgtacgcaaggaacgctggggcccacgcacgctcgacctggacatcttgctg
ttcggcgatcacgtcatcgatgtgccacgactgcaggtgccgcactaccacatgcatgcc
cgccccttcgtgctttacccactggccgaactggtggcagacgactttcacctggccgac
ggccgcccgcttgcccagttgctccaagcctgcccgtttgtcggcctggagcgcctgtag

DBGET integrated database retrieval system