KEGG   Pseudomonas putida W619: PputW619_0762Help
Entry
PputW619_0762     CDS       T00675                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PputW619_0762
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PputW619_0762
DNA repair and recombination proteins [BR:ppw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PputW619_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 AAA_22 AAA_16 UvrD-helicase NACHT AAA_28 DUF2075 AAA_3 PhoH AAA_5 T2SSE NTPase_1 UvrD_C AAA_29 AAA_17
Motif
Other DBs
NCBI-ProteinID: ACA71267
UniProt: B1J3Q7
Position
852136..854211
Genome map
AA seq 691 aa AA seqDB search
MSRTLDDLLPTPLNAEHLLRLAPQRNSADLLQLLDRWVERGWLRALDRAFVSFLEERAPG
SDPLLLLAAALASHQLGHGHVCLDLQQTLAEPDFALSLPPEGDALAGPLLLPSQLLANLD
LHTWRQRIAASPLVAVGNTSGQHSRPLVISGERLYLRRYWSYERQIDETLRQRLSQDEAP
PKDLPARLAQLFDEGALPGQVDWQKLACALATRAGFSIITGGPGTGKTTTVVRLLALLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQMSADVRGQIPTDVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLNALPPKARLILLGDKDQLASVEAGA
VLGDLCRDAEEGCYSPATQAWLEQIGGQSLADSGLKAGDAQRNPLAQQVVMLRFSRRFGE
GSGIGQLARLVNRQQAQAARDLLTRPPADVFGLALRGEHDRAFDRLILDGLNRGAEGPQG
YRSYLRTIGRYRPALGSAFDDPQWEQWAGKVLRSFEDFQLLCAVRKGAWGVEGLNERVAR
VLHSAGLIDSQQPWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDEQGEPLLRVAFPRNDG
SGGVRFVLPSRLNEVETVFAMTVHKSQGSEFSHTALVLPDALNPVLTKELIYTGITRAKH
CFSLVEPRQGIFEGAVARKVRRISGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacccttgatgacctcttgcctaccccactgaacgcagagcacttgctgagg
ctggcgccacaacgcaacagcgcagacctgctgcaactgctcgaccgctgggttgagcgt
ggctggttgcgggccttggaccgggcattcgtgtcctttctggaagagcgcgcacccggg
agcgatccgctcttgctgctggccgctgcgttggccagccatcaactgggccatgggcat
gtctgcctggacctgcagcaaacccttgccgagccggatttcgccctgtcgttgccaccg
gaaggtgatgccctggctggccccttgctgctgccctcacaattgctcgccaacctcgac
ctgcacacctggcgccagcggattgctgccagccccctggttgctgttggcaatacctcg
ggccagcactcacggccattggtgatcagcggcgagcgcctctacctgcgccgctactgg
agttatgagcggcagatcgacgaaaccctgcgccagcgcctgagccaggacgaggctccc
ccaaaagacctgcccgcgcgcctggcgcagctgttcgacgaaggtgctctgccaggccag
gtggattggcagaaactggcttgcgccctggccacccgcgccggcttcagcatcatcacc
ggggggccgggcaccggcaagaccaccacggtggtgcgcctgctggccttgctgcaggct
cctgcggtagagcagggcaggccgctgcgcattcgcctcgcagcgcccaccggcaaggct
gcagcacgcctgaccgaatccattggtcagcaggtcgagcgcttgcagatgagtgcggat
gtccgcgggcagattccaaccgatgtcagcaccgtgcaccggctgctcggcagccgtccg
gggtcgcggcacttccgccaccatgcaggcaacccgctgccgctggatgtgctggtggtg
gatgaagcgtcgatgatcgacctcgaaatgatggccaacctgctcaatgccttgccaccc
aaagcccggttgatcctgctgggggacaaggaccagctggcctcggtcgaggcgggcgcg
gtgctgggcgacctgtgccgggatgccgaagagggctgctactcacccgctacccaggca
tggctggagcagattggcggtcagtcgctggccgacagtggcctgaaggccggcgacgcg
caacgcaatccattggcccagcaggtggtgatgctgcgtttttcccggcgctttggcgaa
ggcagcggcatcggccagctggcgcggctggtcaaccgccagcaagcccaggcggcccgc
gacctgttgaccaggccaccggccgatgtattcggcctggccctgcgcggcgagcacgac
cgtgccttcgatcggctgatactggacggtctgaaccgtggcgctgaggggccacaaggc
tatcgtagctatttgcgtaccattggccgctatcgtccagcgcttggcagtgcctttgac
gatccgcaatgggagcagtgggctggcaaggtgctgcgcagctttgaggacttccagttg
ctgtgcgcggtgcgcaagggcgcctggggggttgaaggcctcaacgagcgggtggcgcga
gtgctgcacagcgccgggttgatcgacagccagcagccctggtacgaagggcgcccggtc
ctggtgacgcgtaacgactacggcctgggcctgatgaacggtgacatcggcatcgccctg
cgcttgccggacgagcagggcgagccgctgctgcgcgtggccttcccacgcaacgacggc
agtggcggggtgcgtttcgtgctgcccagccggctcaacgaggtggaaacggtgttcgcc
atgaccgttcacaagtcccaaggctctgagttcagccacaccgcgctggtactgccggat
gcgctcaacccggtgctgaccaaggagctgatatacaccggtattacccgggccaagcat
tgcttcagcctggtcgaaccacggcagggcatcttcgaaggagcggtcgcacgcaaggta
cggcgtatctccgggttgatgctcgaacaggtgtga

DBGET integrated database retrieval system