KEGG   Pseudomonas putida W619: PputW619_1440Help
Entry
PputW619_1440     CDS       T00675                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppw  Pseudomonas putida W619
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PputW619_1440
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PputW619_1440
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PputW619_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1580713..1581249
Genome map
AA seq 178 aa AA seqDB search
MSILCVFHPSSPALPNKVLTHHDDITATLAEQGVRFDHAALELRIRPGSSQDEVMSACRE
HLDRLMTAQGCAAFSVLNRDGADPAQVDLRDEHVHEVDEVFAVVTGRAQIGLRLGDYVYA
LVCEKGDQLVIPAGSRRWVELGDNPFCLALRLYASEQGMQARFTGDDTARAYAGIDEF
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctctgtgtattccacccgtccagcccggccttgccgaacaaggtactgacc
caccacgacgacatcaccgcaacgctggcagagcagggcgtgcgttttgaccacgctgcg
ctggagctgcgcatacggccaggcagcagccaggatgaagtaatgagcgcctgccgcgaa
caccttgaccggttgatgactgcccagggctgcgcagcgttcagtgtgctcaaccgcgac
ggtgccgacccggcacaggtcgacctgcgcgatgagcatgtgcatgaggttgatgaagta
tttgccgtagtcacaggtcgtgcccagatcgggcttcgcctgggtgactatgtgtatgcg
ctggtgtgtgagaaaggcgaccaactggtgattccggcagggagccggcgctgggtggag
ctgggggacaacccgttctgcctggcgctgcggctgtacgccagcgaacagggcatgcag
gcgcgctttaccggggatgatactgcgcgtgcgtacgccgggatcgacgagttctag

DBGET integrated database retrieval system