KEGG   Pseudomonas putida W619: PputW619_1454Help
Entry
PputW619_1454     CDS       T00675                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00071  Fatty acid degradation
ppw00280  Valine, leucine and isoleucine degradation
ppw00281  Geraniol degradation
ppw00310  Lysine degradation
ppw00360  Phenylalanine metabolism
ppw00362  Benzoate degradation
ppw00380  Tryptophan metabolism
ppw00410  beta-Alanine metabolism
ppw00627  Aminobenzoate degradation
ppw00640  Propanoate metabolism
ppw00650  Butanoate metabolism
ppw00903  Limonene and pinene degradation
ppw00930  Caprolactam degradation
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01212  Fatty acid metabolism
Module
ppw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputW619_1454
   00650 Butanoate metabolism
    PputW619_1454
  Lipid metabolism
   00071 Fatty acid degradation
    PputW619_1454
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputW619_1454
   00310 Lysine degradation
    PputW619_1454
   00360 Phenylalanine metabolism
    PputW619_1454
   00380 Tryptophan metabolism
    PputW619_1454
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputW619_1454
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputW619_1454
   00281 Geraniol degradation
    PputW619_1454
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_1454
   00627 Aminobenzoate degradation
    PputW619_1454
   00930 Caprolactam degradation
    PputW619_1454
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputW619_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACA71959
UniProt: B1J4T7
Position
complement(1592408..1593097)
Genome map
AA seq 229 aa AA seqDB search
MSELITYHAEDGIATLTLNNGKVNAISPDVITAFNAALDRAKEDRAVVIITGQPGILSGG
YDLKVMTAGPKEAISLVTAGSTLARRLLSHPFPVIVACPGNAVAKGAFLLLSADYRIGVE
GPYKICLNEVQIGMTMHHAGIELARDRLNRAAFQRSVNNAEIFDPHGAMQAGFLDKVVPA
EQLLDTALAAARELKKLNMLAHKNTKLKVRKGLLDALDEAIELDQNPLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctgattacctaccacgccgaagacggcatcgccaccctgaccctgaacaac
ggcaaggtcaacgccatctcaccggatgtcatcactgccttcaacgccgccctggaccgc
gccaaggaagatcgcgccgtggtcatcatcaccgggcagccaggcatcctgtccggcggc
tatgaccttaaagtgatgaccgcaggccccaaggaagccatcagcctggtcaccgccggc
tccaccctggcccggcgcctgctctctcacccgttcccggtgattgtcgcctgccccggc
aacgccgtggccaagggcgccttcctgttgttgtccgccgactaccgcatcggtgtcgag
gggccttacaagatctgcctgaacgaagtgcagatcggcatgaccatgcaccacgccggc
atcgaactggcccgcgatcgcctgaaccgcgcagcattccagcgttcggtgaacaatgcc
gaaatcttcgacccacatggcgcgatgcaagcgggcttcctcgacaaggtggtgccggcc
gagcagttgctcgacaccgcactggccgctgcgcgtgaattgaagaagctgaacatgctg
gcgcacaagaacaccaagctgaaggtgcgcaagggcctgctggatgccctggatgaggcg
atcgagctggaccagaacccgctcggttga

DBGET integrated database retrieval system