KEGG   Pseudomonas putida W619: PputW619_1662Help
Entry
PputW619_1662     CDS       T00675                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppw  Pseudomonas putida W619
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_1662
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PputW619_1662
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PputW619_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1845038..1846048
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPD
LILAVDQEGGRVQRLRQGFVRLPAMRAIADNANAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPQRAAQLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAANRIEAALSAGCDMGLVCNDRAAAELALSAAQRLKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALREAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgccaactcctgcgccagccggaagtggctggcctgatcatctttgcccgcaac
atcgacagcccgcgccaggtgcgtgaactgtgcgcgtccatccgcgccattcgtcccgat
ctgattctggccgtcgaccaggaaggtgggcgtgtgcagcgtttgcgtcaaggcttcgtg
cgcctgccagccatgcgcgcgatcgccgataacgccaatgccgagtacctcgccgagcag
tgcggttggttgatggccactgaagtgctggcggttggcctggacctcagcttcgcccct
gtgctcgacctggatcaccagcgtagcgctgtggtcggcagccgcgcgtttgaaggcgac
ccgcaacgtgccgcgcagcttgctggcgccttcatccgcgggatgaacgcagcgggtatg
gctgcctgtggcaagcatttccccgggcatggttgggcggaggcggactcccacgtggcc
attccgacggacgagcgcagccttgagcaactgcgccaggcagatctggtaccgttcacc
cgtctcagcgggcagctggcggcagtcatgccggcgcatgtcatctatccgcaggtagac
aatcagccggccgggttctcgcgtcgttggttgcaggacattctgcgtggcgaactgggc
tttgacggggtgatcttcagtgacgacctgtcgatggctggtgcgcatgtggttggcgat
gcggccaatcggatcgaggcagcgctgagtgcgggttgtgacatgggcctggtgtgcaat
gaccgggcggccgcagagctggctttgagcgcggcgcagcggctgaaggtcaagccatcg
ccgcggattgcacgcatgcgcgggcaggggtttgcgcggaccgattatcgccagcagccg
cgttggctggaggcgctgggggcgttgcgcgaggcgcagttggtcgattga

DBGET integrated database retrieval system