KEGG   Pseudomonas putida W619: PputW619_1666Help
Entry
PputW619_1666     CDS       T00675                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ppw01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppw01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1853663..1855126
Genome map
AA seq 487 aa AA seqDB search
MWKVPVTQKPDQCLGEWIDREALAEAMIPLIGQLYRNNNVVSSIYGRSLINRSVISILKA
HRFARHRQTDETELSVHETFPLLKAMSELKLGAASVDLGKLANKFKQEGNGKTAEQFVRE
ELADVVGQQNASARKGTDVVLYGFGRIGRLLARILIEKTGGGDGLRLRAIVVRKGAENDL
VKRASLLRRDSVHGPFDGTITIDEANNTITANGNLIQIIYAKSPSEVDYTQYGIDNALIV
DNTGVWRDADGLGQHLACPGAARVILTAPGKGALKNIVHGINHGDITAEDKIISAASCTT
NAIVPVLKAINDQYGIVNGHVETVHSFTNDQNLIDNFHKGSRRGRAAPLNMVITETGAAT
AAAKALPVLKGKLTGNAIRVPTPNVSMAILNLNLEKATNREEINEYLRQTAMHSELHKQI
DYVSSQEVVSTDFVGSRHAGVVDAEATIANDNRVVLYVWYDNEFGYSCQVVRVMEDMAGV
NPPAFPR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggttcccgtgactcagaagcccgaccagtgtcttggtgagtggatcgatcgt
gaagctctggctgaagcgatgatcccgcttatcggtcagctctaccgcaacaacaacgtg
gtgagctcgatctatggccgcagcctgatcaaccgttcggttatctcgatcctcaaggcc
caccgctttgcgcgtcaccgtcaaaccgacgaaaccgaactgtccgtccacgagacattc
cccctgctcaaagccatgagcgagctgaaactgggcgccgcttcggtcgacctgggcaag
ctggccaacaagttcaagcaggaaggcaacggcaagaccgccgagcagttcgtgcgtgaa
gaactggccgacgtggttggccagcagaacgcttcggcgcgcaagggcaccgacgttgtc
ctgtacggtttcggccgcatcggccgcctgctggcgcgcatcctgatcgagaagaccggt
ggtggcgacggcctgcgcctgcgtgcaatcgttgtgcgcaagggtgccgaaaacgacctg
gtcaagcgcgccagcctgctgcgccgtgactcggtgcacggcccgttcgatggcaccatc
accatcgacgaagccaacaacaccatcactgccaacggcaacctgatccagatcatctac
gccaagagcccgagcgaagtcgactacacccagtacggcatcgacaacgccctgatcgtc
gacaacaccggcgtatggcgtgatgccgacggcctgggccagcacctggcctgcccgggc
gctgcccgcgtgatcctcaccgcacctggcaagggcgcgctgaagaacatcgtgcacggc
atcaaccacggtgacatcaccgccgaggacaagatcatctcggcagcttcgtgcaccacc
aacgccatcgtgccggtgctcaaggccatcaacgaccagtacggtatcgtcaatggtcac
gttgaaaccgttcactcgttcactaacgaccagaacctgatcgacaacttccacaagggc
agccgtcgcggtcgcgccgcgccgctgaacatggtcatcaccgaaaccggtgctgccact
gctgccgccaaggcgctgccagtgctcaagggcaagctgaccggcaacgccattcgcgta
ccgacgccgaacgtgtcgatggccatcctgaacctgaacctggagaaggctaccaaccgc
gaagaaatcaacgagtacctgcgccagaccgccatgcactcggagctgcacaagcagatc
gattacgtcagctcgcaggaagtggtttccaccgacttcgtaggctcgcgccacgcgggt
gtggtcgacgccgaagcgaccatcgccaacgataaccgcgttgttctgtacgtctggtac
gacaacgaattcggttacagctgccaggtggttcgcgtgatggaagacatggctggtgtg
aacccgccagcgtttccacgctaa

DBGET integrated database retrieval system