KEGG   Pseudomonas putida W619: PputW619_1760Help
Entry
PputW619_1760     CDS       T00675                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppw  Pseudomonas putida W619
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PputW619_1760
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PputW619_1760
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PputW619_1760
Lipid biosynthesis proteins [BR:ppw01004]
 Fatty acid synthase
  Component type
   PputW619_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1958555..1959160
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDTRQGWVSLLQTRLRDEGFDDQV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPEQLQQNLASMIERSRE
SGAKVVLLGMRLPPNYGVRYTTAFAKVYEQLAAEKQVALVPFFLEGVGGVPEMMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcgggaaccttgctggttgttggcgatagtatcagcgccggttttggcctggatacccgc
caggggtgggtctctttgttgcagacccggctcagggacgaaggtttcgatgatcaggtg
gtcaacgcttcgatcagcggcgacaccagtgcagggggccaggcgcggctgcctgcgctg
cttgcagcgcacaagcccagcctagtggtgctggaattgggcggcaacgacgggctgcgc
gggcagcctccagagcaattgcaacaaaatcttgcctcgatgatcgagcggtcacgcgag
tccggggccaaggtcgtgctgctgggcatgcgtctgccgcccaattatggggtgcgctac
accacggcgttcgccaaggtttatgagcagctggcagcggagaaacaggtggcactggtg
ccgtttttcctcgagggcgtagggggagtgccggagatgatgcaggccgatggcatccat
ccggcgcagggtgcccagcagcggttgctggaaaatgcctggccagcgataaaacccttg
ctctga

DBGET integrated database retrieval system