KEGG   Pseudomonas putida W619: PputW619_1822Help
Entry
PputW619_1822     CDS       T00675                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppw  Pseudomonas putida W619
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2034072..2036141)
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLAARVGLARDWIDANNRPQQVSDEVLRKVLEALGHPASDDRAIQDSLRAVDA
AEDSEHLPPLLTADLGQPLALARYFSAGSAARCTLEDDSQLDLTLDNQAQLPGALPLGYH
RIAIDGRTFTVAVAPLRCHSLEDAVEQPPPRCWGIAAQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHALSAFDQQHYSPYSPSSRLLLNPLYASPAAVLGERAVRMAVEA
CGLEQTLEDLEQRPLVDWPRAADARLRLLDALYQSFIQADHPLRKDFESFREAGGQALEH
HCRFEVLQAHAVDDGLGADWRNWPSAWHDPYHPEVEAFASAYPAKVEFHAFCQWLTERSL
QRAQEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLANLKVGAPPDILNRSGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPRGCKPDEGAYLQYPL
EDLLRLLALESVRHQAIILGEDLGTVPEGLREELAAKAVLGMRVLPFEQAQPGHFTPILD
WPDKALATTGTHDLAPLAGWLQNRDIDWSQRLQLIDDATELHWRQARQKERDGLRRTLEA
NYGPLKDNDHLIDAAIRYVGHTRAPLVLIPLEDLLGSEEQPNLPGTTEGHPNWRRRFEHP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccgcattacaccgcctggctgcccgtgtagggctggcccgcgactggatc
gacgccaacaacaggccgcaacaggtcagcgacgaggtgctgcgcaaggtccttgaagcg
ctcggccacccggccagtgacgaccgtgccatccaagacagcctgcgcgccgtggacgcc
gccgaagacagcgaacacttaccgccgctgttgaccgccgaccttggccagcctttggca
ctggcgcgctacttcagcgcaggcagcgccgcccgctgcaccctggaagacgacagccag
ctcgatctgaccctcgacaaccaggcacaactgcctggcgcattgcccttgggctatcac
cgcatcgctatcgatggccgtactttcacagtggccgtggcgccgctgcgttgccacagc
ctggaggacgctgtcgaacagccgccaccgcgctgctggggcattgcggcgcagctttac
agcctgcgccgcccaggtgatggcggctacggcgactgcctggccctggagcaactggcg
cgcagcgcggcagaacgtggtgccgacgccctcgccatcagcccgatccacgccctgtca
gcgttcgaccagcaacactacagcccctactcaccctccagccgcctgctgctcaacccc
ctgtatgccagccccgctgccgtgctcggtgaacgtgccgtgcgcatggccgtcgaggcc
tgtggcctggagcaaaccctggaagacctcgagcaacgcccgctggtcgactggccacgc
gccgccgacgcccgcctgcgcctgctcgacgcgctgtaccagagtttcatccaggcggat
caccccctgcgcaaagacttcgagagcttccgcgaggccggtggccaggcgctggagcac
cactgccgctttgaagtgctgcaggcacacgccgtggacgacggcctgggtgccgactgg
cgcaactggccgagcgcctggcacgacccctatcacccagaagtggaggccttcgccagc
gcgtatcccgccaaggtcgagttccatgcgttctgccagtggctgaccgagcgcagcctg
cagcgcgcgcaggaagccgcccgtggcaacggcatggcggtcggcctgatcgccgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggacgagttgctggcc
aacctgaaggttggcgccccgccggacatcctcaaccgcagcggacaggactggggcatc
tgcgcattctcgcccgaaggcctcaaacgcaatggctaccgcgccttcatcgaaatgctg
cgggccaacctggcccatgccggcggcctgcgcattgaccatgtgatgggcctgcgccgc
ctgtggctgatcccgcgtggctgcaagcccgacgaaggggcctacctgcagtatccgctg
gaggacctgctgcgcctgctggccctggagtcagtgcggcaccaggcaatcatcctcggt
gaagacctgggcaccgtgcctgaaggcctgcgcgaagaactggcggccaaggccgtgctg
ggcatgcgcgtactgcctttcgagcaggctcagcccggccacttcacgccgattctcgac
tggccggacaaagccttggccaccaccggcacccacgacctggcacctctggccggctgg
ctgcaaaaccgcgacatcgactggagccagcgcctgcaactgatcgatgacgccaccgag
ctgcactggcgtcaggcgcgacagaaagagcgtgacggcctgcgccgcaccctggaagcc
aattacggcccactaaaggacaacgaccacttgatcgatgctgccatccgttacgttggt
cacacccgcgcaccgctggtgctgatcccgctcgaagacctgctcggcagtgaagagcaa
cccaacctccccggcacgaccgaaggccaccccaactggcgccggcgattcgagcacccg
gtgcgcgaactgctcgacgatgaagatgccgcgcgccgcctggagctgttggcccaggcc
cgcgaacaagcctgggagcgtgaccgatga

DBGET integrated database retrieval system