KEGG   Pseudomonas putida W619: PputW619_1960Help
Entry
PputW619_1960     CDS       T00675                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppw  Pseudomonas putida W619
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PputW619_1960
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PputW619_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2189532..2190440
Genome map
AA seq 302 aa AA seqDB search
MSAKVVVVGSLNMDLVARAERLPRAGETLAGESFFTVPGGKGANQAVAAARLGASVAMVG
NVGDDAYGQQLRQALEVEGIDCQAVSACPGVSSGVALITVDAASQNCIVIIPGGNGQLTS
ASVQRFDALLQAAEVVICQLEVPADTVAWALARGRELGKTVILNPAPATGPLPAQWFAHI
DYLIPNESEAEALAGEPVNDLASARRAGERLLQLGAGKVIVTLGAQGALFVSRDGSRHFP
APQVKALDTTAAGDTFVGGFAAALVRGLEEGEAITFGQRAAALSVTRAGAQPSIPTLAEL
AP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaaggtcgtggtggtcggtagcctcaacatggacctggtggcccgcgccgag
cggctgccacgtgcaggcgaaacactggccggcgaaagctttttcaccgtgccgggcggc
aagggcgccaaccaggcggtggccgcggcgcgcctgggcgcgagcgtggccatggtcggc
aacgtcggcgatgacgcctacggccagcagctgcgccaggcccttgaggttgagggtatc
gattgccaggcggtgagcgcgtgcccgggcgtctccagtggcgtggcgctgattaccgta
gatgccgccagccagaactgcatcgtcatcatccccggcggcaacggccagctgacctcg
gcaagcgtgcagcgtttcgacgcactgttgcaggctgccgaggtggtcatctgccagctc
gaagtgcccgccgacaccgtggcctgggctctggccagggggcgtgagctgggcaagacg
gtgatcctcaacccggccccggccaccggcccgctgcccgcgcagtggttcgcccatatc
gattacctcatccccaacgaaagcgaggccgaggcgctggccggtgagccggtcaacgac
ctggccagcgcccgccgtgccggcgagcgtctgctgcaactgggcgccggcaaggtcatc
gtcacccttggtgcgcagggcgcgctgttcgtcagccgagatggcagccggcacttcccg
gcgccgcaggtcaaagcgctggacaccacggcagcgggcgacacctttgttggcggtttt
gcagccgcgctggtgcgcggcctggaggagggtgaagcgatcaccttcggccaacgcgct
gcggcgctgtccgtcactcgcgccggtgcgcagccttcgatcccgaccttggcggagctg
gccccatga

DBGET integrated database retrieval system