KEGG   Pseudomonas putida W619: PputW619_2008Help
Entry
PputW619_2008     CDS       T00675                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppw  Pseudomonas putida W619
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PputW619_2008
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_2008
   00650 Butanoate metabolism
    PputW619_2008
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PputW619_2008
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_2008
   00622 Xylene degradation
    PputW619_2008
   00621 Dioxin degradation
    PputW619_2008
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PputW619_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2240712..2241659)
Genome map
AA seq 315 aa AA seqDB search
MSSTRIPVAIIGSGNIGTDLMIKILRCSDTLEVGAMVGIDPASDGLARAERLGVPTTAGG
IDGLLALPNFKEIRIAFDATSAGAHKVHDSKLRAHGVRIIDLTPAAVGPYVVPVVNFAEH
AHEPNLNMVTCGGQATIPIVHAVAGVAPVHYAEIVAAISSKSAGPGTRANIDEFTETTSR
AIVEVGGAARGKAIIVLNPAEPPLIMRDTVYCFVPLDADTQAIVDAVEQRVAEVNRYVPG
YRLKQHVQFEHFTENNRQNIPGLGWSTGIKVAVYLEVEGAGHYLPAYAGNLDIMTSAALT
VAERIAQAQFTDQGL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctactcgcataccggtagcgatcatcggctctggcaacattggcaccgacctg
atgatcaagatccttcgctgctccgatacgcttgaggtgggagccatggtgggtatcgac
ccggcctcagacggtttggcccgcgctgagcgcctcggtgtacccaccaccgcaggcggg
atcgacgggctgctcgcgctgcccaatttcaaggaaatccgcatcgccttcgatgccacc
tccgcaggggcgcacaaggtgcatgacagcaagctgcgtgcccatggggtgcgcatcatc
gaccttacccctgcagccgtcggcccgtatgtcgtcccggtggtgaacttcgccgagcac
gcccacgagccgaacctgaacatggtcacctgcggcggccaggcgaccatcccgatcgtg
catgcggtggcgggcgtggcgccggtgcattacgccgagatcgtcgcggcaatctccagt
aagtcggccggccccggcacccgtgccaacatcgacgaattcaccgagaccacctcacgc
gcgatcgtcgaggtcggcggcgcggcgcgcggcaaggcgatcatcgtgctcaacccggcc
gagccgccattgatcatgcgcgacacggtgtattgcttcgtgccactggacgccgacacc
caagccatcgtcgacgcggtcgagcagcgcgtggccgaggttaaccgctacgtgccgggt
taccgcctcaaacaacacgttcagttcgagcacttcaccgagaacaaccggcagaacatc
cctggcctgggctggagcaccggcatcaaagtcgcggtgtatctcgaagtggaaggtgcc
gggcactacctgccggcttacgccggcaatctggacatcatgaccagcgcggcgctgacc
gtcgctgaacgtatcgcccaggcgcagttcactgatcaggggttgtga

DBGET integrated database retrieval system