KEGG   Pseudomonas putida W619: PputW619_2008Help
Entry
PputW619_2008     CDS       T00675                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppw  Pseudomonas putida W619
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppw00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppw00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ppw00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ppw00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ppw00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2240712..2241659)
Genome map
AA seq 315 aa AA seqDB search
MSSTRIPVAIIGSGNIGTDLMIKILRCSDTLEVGAMVGIDPASDGLARAERLGVPTTAGG
IDGLLALPNFKEIRIAFDATSAGAHKVHDSKLRAHGVRIIDLTPAAVGPYVVPVVNFAEH
AHEPNLNMVTCGGQATIPIVHAVAGVAPVHYAEIVAAISSKSAGPGTRANIDEFTETTSR
AIVEVGGAARGKAIIVLNPAEPPLIMRDTVYCFVPLDADTQAIVDAVEQRVAEVNRYVPG
YRLKQHVQFEHFTENNRQNIPGLGWSTGIKVAVYLEVEGAGHYLPAYAGNLDIMTSAALT
VAERIAQAQFTDQGL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctactcgcataccggtagcgatcatcggctctggcaacattggcaccgacctg
atgatcaagatccttcgctgctccgatacgcttgaggtgggagccatggtgggtatcgac
ccggcctcagacggtttggcccgcgctgagcgcctcggtgtacccaccaccgcaggcggg
atcgacgggctgctcgcgctgcccaatttcaaggaaatccgcatcgccttcgatgccacc
tccgcaggggcgcacaaggtgcatgacagcaagctgcgtgcccatggggtgcgcatcatc
gaccttacccctgcagccgtcggcccgtatgtcgtcccggtggtgaacttcgccgagcac
gcccacgagccgaacctgaacatggtcacctgcggcggccaggcgaccatcccgatcgtg
catgcggtggcgggcgtggcgccggtgcattacgccgagatcgtcgcggcaatctccagt
aagtcggccggccccggcacccgtgccaacatcgacgaattcaccgagaccacctcacgc
gcgatcgtcgaggtcggcggcgcggcgcgcggcaaggcgatcatcgtgctcaacccggcc
gagccgccattgatcatgcgcgacacggtgtattgcttcgtgccactggacgccgacacc
caagccatcgtcgacgcggtcgagcagcgcgtggccgaggttaaccgctacgtgccgggt
taccgcctcaaacaacacgttcagttcgagcacttcaccgagaacaaccggcagaacatc
cctggcctgggctggagcaccggcatcaaagtcgcggtgtatctcgaagtggaaggtgcc
gggcactacctgccggcttacgccggcaatctggacatcatgaccagcgcggcgctgacc
gtcgctgaacgtatcgcccaggcgcagttcactgatcaggggttgtga

DBGET integrated database retrieval system