KEGG   Pseudomonas putida W619: PputW619_2066Help
Entry
PputW619_2066     CDS       T00675                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PputW619_2066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_2066
  Lipid metabolism
   00071 Fatty acid degradation
    PputW619_2066
  Amino acid metabolism
   00350 Tyrosine metabolism
    PputW619_2066
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PputW619_2066
   00626 Naphthalene degradation
    PputW619_2066
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PputW619_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2300482..2301492
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAKGRRVEVVEKNLRPLAHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVVEVGPGVTSLKPGDRASVAWFFQGCGHCEYCNSGNETLCREVKNSGYTVDGGMAEA
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKSSNIRPGQWIAVYGLGGLGNLALQY
AKNVFNARVIAIDVNDEQLAFAREMGADLVVNARSEDVAKVIQAQTGGAHAAVVTAVSKS
AFNSAVDALRAGGRLVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLAEAFEFAAQG
KVVPKVTLRPIEDINDIFEEMLEGKIKGRMVINFAD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagttgttgcaaaagggcgccgcgtggaggtggtggaaaaaaacctgcgc
ccgcttgcgcacggtgaagcgttgctgaagatgcagtgctgtggcgtgtgccataccgac
ctgcacgtcaaaaatggcgatttcggtgacaagaccggcgtgatcctcggccacgagggt
attggtgtggtggtggaggtagggccgggcgtcacttcgctcaagccgggcgaccgggcc
agcgtggcgtggttcttccagggctgtgggcactgcgagtactgcaacagcggtaacgaa
acgctgtgccgtgaggtgaagaactctggctataccgtcgacggcggcatggccgaggcg
tgcatcgtggtggccgactacgcggtaaaggtgcccgacgggctcgactcggctgccgcc
agtagcatcacctgcgccggtgtgaccacctacaaagcggtgaaatcgtccaacatccgc
cccgggcagtggattgcagtttacggcctcggcgggctgggcaacctggccctgcagtat
gcgaagaatgtcttcaacgcccgggtcatcgcgatcgatgtgaatgatgagcaactggcg
ttcgcccgtgaaatgggcgccgacctggtggtcaatgcgcgcagtgaggatgtagccaaa
gtcatccaggcgcaaaccggtggcgcgcatgcggccgtggtgacggcggtgtcgaaaagc
gcgttcaactctgcggtcgatgcgctgcgtgccggcggccgactggtggctgtcgggctg
ccgccagaggccatgagcctggacattccgcgcctggtgctcgatggcatcgaagtggtc
ggttcactggtcggtacccgccaggacttggctgaagccttcgagtttgctgcgcaaggc
aaggttgtgccgaaggtgaccctgcgtccgatcgaagacatcaacgacattttcgaagag
atgctggaaggtaagatcaagggtcggatggtgatcaacttcgcggattga

DBGET integrated database retrieval system