KEGG   Pseudomonas putida W619: PputW619_2066Help
Entry
PputW619_2066     CDS       T00675                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00010  Glycolysis / Gluconeogenesis
ppw00071  Fatty acid degradation
ppw00350  Tyrosine metabolism
ppw00625  Chloroalkane and chloroalkene degradation
ppw00626  Naphthalene degradation
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_2066
  Lipid metabolism
   00071 Fatty acid degradation
    PputW619_2066
  Amino acid metabolism
   00350 Tyrosine metabolism
    PputW619_2066
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PputW619_2066
   00626 Naphthalene degradation
    PputW619_2066
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PputW619_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 TrkA_N CoA_binding Methyltransf_11 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ACA72566
UniProt: B1J778
Position
2300482..2301492
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAKGRRVEVVEKNLRPLAHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVVEVGPGVTSLKPGDRASVAWFFQGCGHCEYCNSGNETLCREVKNSGYTVDGGMAEA
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKSSNIRPGQWIAVYGLGGLGNLALQY
AKNVFNARVIAIDVNDEQLAFAREMGADLVVNARSEDVAKVIQAQTGGAHAAVVTAVSKS
AFNSAVDALRAGGRLVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLAEAFEFAAQG
KVVPKVTLRPIEDINDIFEEMLEGKIKGRMVINFAD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagttgttgcaaaagggcgccgcgtggaggtggtggaaaaaaacctgcgc
ccgcttgcgcacggtgaagcgttgctgaagatgcagtgctgtggcgtgtgccataccgac
ctgcacgtcaaaaatggcgatttcggtgacaagaccggcgtgatcctcggccacgagggt
attggtgtggtggtggaggtagggccgggcgtcacttcgctcaagccgggcgaccgggcc
agcgtggcgtggttcttccagggctgtgggcactgcgagtactgcaacagcggtaacgaa
acgctgtgccgtgaggtgaagaactctggctataccgtcgacggcggcatggccgaggcg
tgcatcgtggtggccgactacgcggtaaaggtgcccgacgggctcgactcggctgccgcc
agtagcatcacctgcgccggtgtgaccacctacaaagcggtgaaatcgtccaacatccgc
cccgggcagtggattgcagtttacggcctcggcgggctgggcaacctggccctgcagtat
gcgaagaatgtcttcaacgcccgggtcatcgcgatcgatgtgaatgatgagcaactggcg
ttcgcccgtgaaatgggcgccgacctggtggtcaatgcgcgcagtgaggatgtagccaaa
gtcatccaggcgcaaaccggtggcgcgcatgcggccgtggtgacggcggtgtcgaaaagc
gcgttcaactctgcggtcgatgcgctgcgtgccggcggccgactggtggctgtcgggctg
ccgccagaggccatgagcctggacattccgcgcctggtgctcgatggcatcgaagtggtc
ggttcactggtcggtacccgccaggacttggctgaagccttcgagtttgctgcgcaaggc
aaggttgtgccgaaggtgaccctgcgtccgatcgaagacatcaacgacattttcgaagag
atgctggaaggtaagatcaagggtcggatggtgatcaacttcgcggattga

DBGET integrated database retrieval system