KEGG   Pseudomonas putida W619: PputW619_2108Help
Entry
PputW619_2108     CDS       T00675                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppw  Pseudomonas putida W619
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputW619_2108
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PputW619_2108
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputW619_2108
Two-component system [BR:ppw02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PputW619_2108
Bacterial motility proteins [BR:ppw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PputW619_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2341739..2342314
Genome map
AA seq 191 aa AA seqDB search
MKGVNAVVIGASAGGVQALFQVLGGLPPAFVTPVLCVLHLPDDRHSHLAEVLQRRLHRPV
SEARDKEAIAPGQIYVATPGYHLSVEQDLSLSLSQEEPVHFSRPAIDFLFISAADAYGAG
LLGVLLTGANEDGAKGLAYIKSSGGRTVVQDPCDAQVALMPEAALALHQPDLILSLSGIG
QLLANLESSAC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtaaacgcggtggtgatcggtgcctcggcgggcggcgtgcaggcgctgttt
caggtgctcggcggcctgccgccggcattcgtgacgcctgtgctgtgcgtgctgcacctg
cccgatgaccgtcacagccatctggccgaagtgctgcagcggcgcctgcacaggccggta
agcgaggctcgggacaaagaggccatcgcccctggccagatctacgtggcgacccctggt
tatcacctgtcggtcgagcaggatttgagcctgtcgctgagccaggaggaaccggtgcat
ttctcgcgcccggccattgacttcctgttcatctcggctgccgatgcctatggcgcgggc
ctgttgggtgtattgctcacaggcgccaacgaggacggtgccaaaggccttgcctacatc
aagagcagcggcggccggaccgtggtccaggacccctgcgacgcccaggtggcgctgatg
ccggaggccgcattggcgctccaccagcccgaccttattctttctttgagcggtatcggg
caattgctcgccaacctggaatccagcgcatgctaa

DBGET integrated database retrieval system