KEGG   Pseudomonas putida W619: PputW619_2302Help
Entry
PputW619_2302     CDS       T00675                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00620  Pyruvate metabolism
ppw00630  Glyoxylate and dicarboxylate metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_2302
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_2302
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PputW619_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACA72802
UniProt: B1J7V0
Position
complement(2574994..2577171)
Genome map
AA seq 725 aa AA seqDB search
MTERVPCQRLQVAENFKHFIEDEVLPGTEITSDHFWRGLDALVHDLAPRNRALLAERVHL
QGELDTWHRAHPGSVTDMEAYQRFLGSIGYLLPQPEKVKVGTDHVDREVAVQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAIAEDGGASKGPGYNPVRGARVIAFARAFLDQAF
PLQGGSHVDASAYQVVDGQLRVSLHSGEAIGLAQSDQFVGHQGEASSPTVVLLVHHDLHV
EIQIDPTSPVGSTDAAGVKDLVLESALTTIMDCEDSVAAVDADDKVAVYRNWLGLMKGNL
TETVSKNGKAFTRTLNPDRTYQGRDGKPVTLPGRSLLFVRNVGHLMSTPTILDQEGQEIP
EGILDAVITSLAAVHDLRRRGNSRSGSVYIVKPKMHGPAEVAFANRLFGRVEDLLGLAPH
TLKMGIMDEERRTSINLKACIAEAANRVVFINTGFLDRTGDEMHSTMEAGAMLRKGDMKS
TPWIQSYERNNVLVGLDCGLRGRAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQVDVRQVQQELERIDLDSQRAELLQGLLSVPVSVDRNWSPTEIQAELDN
NCQSILGYVVRWIEQGVGCSKVLDIHDVGLMEDRATLRISAQHIANWLHHRVVSTGQVRA
ALERMAQVVDGQNAGDQAYRPMAPDFESSHAFRAACDLVFKGREQPSGYTEPLLHAWRLR
FKQAR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtgccatgccagcgtttgcaggtggctgagaacttcaagcacttcatc
gaggatgaggtgctccccggcaccgagattacgtcggatcatttctggagggggctcgat
gccctggtgcacgatctggcgccgcgcaaccgcgctttgctggccgagcgtgttcacttg
cagggcgaattggatacctggcaccgcgcccaccccgggtcggtaacggacatggaggcc
tatcagcgcttccttggcagcatcggttatctgctgccacaacctgaaaaggttaaggtc
ggcacggaccatgtcgaccgtgaggtagcagtgcaggccggcccgcagttggtggtgccg
gtgatgaacgcacgctatgcgctcaacgccgctaatgcccgttggggctcgttgtacgat
gccctgtatggcaccgacgccatcgccgaagacggcggcgccagcaaggggcctggatac
aatccggtgcgtggcgctcgagtcattgcgttcgcccgcgccttcctcgaccaggccttc
cccctgcagggcggttctcacgtcgatgccagcgcctaccaggtagtggatggtcaattg
cgggtatcgctgcatagcggtgaagcgatcggtttggcccaatcggatcaattcgttggt
caccagggcgaagcatcgtcaccgaccgtcgtactgctcgtgcatcatgacttgcacgtg
gagatccagatcgacccgaccagcccagtcggcagcaccgatgccgctggcgtcaaggac
ctggtgctggagtcggccttgaccaccatcatggactgcgaagattcagtggccgcggtc
gatgccgatgacaaggtggctgtctaccgtaactggctgggcctgatgaagggcaacctg
actgaaaccgtgagcaagaacgggaaggcattcacgcgtaccctgaaccctgaccgcacc
taccagggccgcgacggtaaaccagtaaccctgccggggcgctcgctgctgttcgtgcgc
aacgttggtcatctgatgagcaccccaaccatcctcgatcaggaaggtcaggagattccc
gaaggaattctcgatgccgtaatcactagccttgcagccgttcacgacctgcgccgccgc
ggcaactcgcgtagcggcagcgtctatattgtgaagcccaagatgcacggccctgctgag
gtagcatttgccaacaggctgtttggtcgagttgaggatcttcttggcctggcccctcat
accttgaagatgggcatcatggacgaggagcgccgcaccagcatcaacctcaaggcgtgc
atcgccgaagccgccaatcgcgtggtgttcatcaataccggattcctcgaccgtacgggc
gacgagatgcactcgaccatggaagccggcgccatgctgcgcaagggcgacatgaagtcg
actccctggatccagtcctatgagcgcaacaacgtactggtggggctggactgtggcctg
cgtggacgtgcgcaaatcggcaagggcatgtgggccatgccggacctgatggcagccatg
cttgaacagaaaattgctcaccccaaggccggtgccaacaccgcgtgggtaccttcgcct
accgccgcgacgctgcacgcgctgcactaccaccaggtagacgtgcgtcaagtgcaacaa
gagttggaacgcatcgacctagacagccagcgcgccgagttgctgcaaggcctgctcagt
gtgccggtcagtgtcgatcgcaattggagcccgaccgagatccaggcagaactggataac
aactgccagagcatccttggctatgtagtgcgctggatcgaacagggcgttggttgttcc
aaagtgctcgatatccacgacgtaggtttgatggaagaccgcgccaccctgcgtatctcc
gcccagcatattgcgaactggctgcaccatcgtgtggttagcactggccaagtccgtgca
gcgctggagcgcatggctcaggtggtcgatgggcagaatgctggggaccaagcctaccgc
ccgatggcgccggactttgaaagcagccatgccttccgagccgcctgtgacctggtgttc
aagggacgtgagcagccaagtggctacacagagccgctgcttcatgcctggcggttgcgc
ttcaaacaggctcgctga

DBGET integrated database retrieval system