KEGG   Pseudomonas putida W619: PputW619_2696Help
Entry
PputW619_2696     CDS       T00675                                 

Definition
methanol/ethanol family PQQ-dependent dehydrogenase
Orthology
K17760  
quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
ppw  Pseudomonas putida W619
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2985753..2987933)
Genome map
AA seq 726 aa AA seqDB search
MNRTGPHRRPLPHLLSCLALSLACSAPAFAAEVDGQRIIEADKEPGNWMSHGRTYDEQRY
SPLKAINQGNVNQLGLAWSYKLDLDRGVEATPIVVDGVMYTTGPFSVVYALDARNGTLLW
KYDPQSDRHRAGEACCDAVNRGVAVWQGKVYVGVLDGRLEAIDAKTGKRVWSVDTRDDDK
RSYTITGAPRVVNGKVIIGNGGAEFGVRGYVTAYDAETGKQAWRFFTVPGDPKLPPENKA
MEIASKTWHGDAYVEWGGGGTAWDSFAYDPELNLLYIGVGNGSMWDPKWRSQAKGDNLFL
SSIVAVNADTGEYVWHYQTTPGDAWDFTATQHMILAELPIDGKPRKVLMQAPKNGFFYVL
DRATGELLSAKNIVPVNWAKGIDMKTGRPIFDDEAAAYWKDGKRKLVTPAFWGAHDWHPM
SYNPDTGLVYIPAHIMSAYYEHIPEAPKRNPFKSVYQLGLRTGMMPEGAEGLLDMAKSWS
GKLIAWDPVKQAPAWEVPYITIFNGGTLSTGGNLVFEGSADGRVIAYAADSGKKLWESPA
ASGVMAAPITYSVDGEQYVTFMAGWGGAFSTFAGALSLRAGVQPFAQVLTYKIGGTAKLR
EPAPPADAPEPPALTADAQTVAAGAALYDGNCSQCHGIHAVSGGVLPDLRKLTAEKHQMF
LGILYGGRVPDGMPSFADNLKPEQVEQVHQYLIKRAHDLKAEGDAWQRFSAKPVAQPPLA
DNTPQE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaacaggcccgcaccgtcggcctctgccgcacttgctgagctgcctggcctta
agcctggcgtgcagcgcacctgccttcgccgccgaagtcgacggccagcgcatcatcgaa
gccgacaaggaacccggcaactggatgagccacggccgtacctatgacgagcagcgctac
agcccgctcaaggcgatcaaccagggcaacgtcaaccagctcggccttgcctggagctac
aagctcgaccttgaccgtggcgtggaggcaacaccaatcgtggttgacggggtgatgtac
accaccgggccgttttcggtggtgtacgccctggacgcgcgcaatggcacgctgctgtgg
aagtacgacccgcagtctgaccgccaccgcgccggtgaggcctgttgtgacgcggtcaac
cgaggcgtggcggtgtggcagggcaaggtctacgtgggtgtgctcgatggccgcctggag
gcgatcgatgccaagaccggcaaacgtgtgtggtcggtggacacccgcgatgacgacaag
cgcagctacaccatcaccggggcgccgcgggtggtcaacggcaaggtgatcatcggcaat
ggcggcgccgaattcggtgtgcgcggctacgtgactgcgtacgacgccgaaaccggcaaa
caggcctggcgcttctttaccgtgccgggcgaccccaagctgccgcccgagaacaaagcg
atggaaatcgccagcaagacctggcacggcgacgcttatgtcgagtggggtggcggcggt
acggcctgggattcgttcgcctacgacccggaactcaacctgttgtatatcggcgtgggc
aatggctcgatgtgggacccgaaatggcgcagccaggccaagggcgacaacctgttcctt
tcctcgatcgtcgcggtcaatgccgacaccggcgaatacgtctggcactaccagaccacg
ccaggcgatgcttgggacttcaccgccacccagcacatgatcctggccgagctgcccatt
gacggcaaaccgcgcaaagtgctgatgcaggcgccgaaaaacggcttcttctatgtgctg
gaccgtgctaccggtgagctgctgtcggcgaagaacatcgtgccggtgaactgggccaaa
ggtatcgacatgaagaccgggcggccgatcttcgacgatgaggcggcggcctactggaag
gacggcaagcgcaagctggtgaccccggcgttctggggtgcccacgattggcacccaatg
tcctacaaccctgacacgggcctggtgtacatcccggcgcatatcatgtcggcctactac
gagcacatccccgaggcgccgaagcgcaacccgttcaagagcgtttaccagttggggctg
cgcaccggcatgatgcctgaaggcgccgaaggcctgctggacatggccaagagctggtcg
ggcaagctgatcgcatgggacccggtcaagcaggcgccggcgtgggaggtgccgtacatc
accatcttcaacggtggcaccctgagcactggcggcaacctggtgttcgagggtagcgcc
gacggccgggtgatcgcctacgccgccgattcgggcaaaaagctctgggagtcgcccgcc
gccagcggcgtgatggctgcgccgatcacctattcggtggacggcgagcagtacgtgacg
ttcatggccggctggggcggggcgttttctacctttgccggggcgctgtcattgcgtgcg
ggcgtgcagccgttcgcccaggtgctgacctacaagatcggcggtaccgccaagttgcgt
gagccggcgccaccggccgatgcaccggagccgcccgcgttgaccgccgatgcgcaaacg
gtcgctgccggggcagccctgtatgacggcaactgctcgcaatgccacggtatccacgcc
gtcagtggtggtgtgctgcccgacctgcgcaagctcactgccgaaaagcaccagatgttc
ctcggcatcctctatggcgggcgcgtacccgatggcatgccttcgttcgccgacaacctc
aaacccgagcaggtcgagcaggtgcaccagtacctgatcaagcgcgcccatgacttgaag
gccgaaggcgatgcctggcagcggttcagcgccaagcccgtcgcccagccgccactggcc
gataacacaccacaggagtga

DBGET integrated database retrieval system