KEGG   Pseudomonas putida W619: PputW619_3189Help
Entry
PputW619_3189     CDS       T00675                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppw  Pseudomonas putida W619
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PputW619_3189
   00052 Galactose metabolism
    PputW619_3189
   00500 Starch and sucrose metabolism
    PputW619_3189
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_3189
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PputW619_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3528257..3529096)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGQPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYNQFRCSIIAIQEVDPQETNKYGVIAGDMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIRNTPPGKGGEIQITDALMQQAQN
GCVIAYKFKGQRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccggcagccggttacggcactcgcttcctgcctgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaggccctggacgctggcctgaacgagatttccattgtcaccggccgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaaaggcaccgac
aaggaaaaatacctggtcggcatccgccgcctgctcaacgagtgctcgttctcctacacc
cgccagaccgaaatgaaaggcctgggccacgccattctgaccggccagccgctgatcggt
gacgaaccgtttgccgtggtgctggcggacgacctgtgcgtcaacccggaaggtgatggc
gtactgacccagatggtcaagctgtacaaccagttccgctgctcgatcatcgccatccag
gaagtcgatccgcaggaaaccaacaagtacggcgtgattgccggcgacatgatccgcgat
gacatcttccgtgtgaccaacatggtcgaaaagcctgcgccggaagacgccccatctaac
ctggcgatcatcggccgctacatcctgaccccggatatcttcgatatcatccgcaacacc
ccaccgggcaagggcggcgagatccagatcaccgacgcactgatgcagcaggcacagaac
ggctgcgtgatcgcctacaagttcaagggccagcgtttcgactgcggtggcgccgaaggc
tatatcgacgcgaccaatttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system