KEGG   Pseudomonas putida W619: PputW619_3389Help
Entry
PputW619_3389     CDS       T00675                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00630  Glyoxylate and dicarboxylate metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_3389
Enzymes [BR:ppw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PputW619_3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACA73873
UniProt: B1JBC5
Position
3732720..3734045
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSLQPEHTLARLGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVIGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgccgatgtcgttcgcctgcgtggctcc
ctgcagccggagcacaccctggcccgcctgggtgcagaaaaactgtggaagctggtcacc
gagggtgcccacccgtccttccgcccagaaaaagatttcgtcaactgcatgggcgccctg
accggcggccaggcagtgcagcaggtcaaggccggcatccaggccatctacctgtctggc
tggcaggtggccgccgacaacaactcggccgagtccatgtaccctgaccagtcgctgtac
ccggtcgactccgtaccgactgtggtcaagcgcatcaacaactcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
ccaatcgtagcggacgctgaggccggtttcggcggcgtgttgaacgcctacgaactgatg
aagaacatgatcgaagcgggcgccgccggcgtgcacttcgaagaccagctggcctcggtg
aaaaagtgtggccacatgggcggcaaggtcctggtacctacccaggaagccgtgcagaag
ctggttgcagcgcgcctggccgctgacgtatcgggcgtaccgaccatcatcctggcccgc
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtgatcggtgagcgtacccgtgaaggcttctacaaggtccgcgccggcctcgaccaggcc
atcgcccgcggccttgcctacgcgccatacgccgacctgatctggtgcgaaaccgccaag
ccagacctggacgaagcacgccgcttcgccgaagcgatcaagaaggaatacccggaccaa
ctgctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaaattccagcgcgagctgtcggccatgggctacaaacaccagttcatcaccctg
gctggtatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgccgacgccagcaaaggctac
accttcgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
attcagggtggcgcatcctcggtgacggcactgaccggttcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system