KEGG   Pseudomonas putida W619: PputW619_3389Help
Entry
PputW619_3389     CDS       T00675                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppw  Pseudomonas putida W619
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputW619_3389
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_3389
Enzymes [BR:ppw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PputW619_3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3732720..3734045
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSLQPEHTLARLGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVIGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgccgatgtcgttcgcctgcgtggctcc
ctgcagccggagcacaccctggcccgcctgggtgcagaaaaactgtggaagctggtcacc
gagggtgcccacccgtccttccgcccagaaaaagatttcgtcaactgcatgggcgccctg
accggcggccaggcagtgcagcaggtcaaggccggcatccaggccatctacctgtctggc
tggcaggtggccgccgacaacaactcggccgagtccatgtaccctgaccagtcgctgtac
ccggtcgactccgtaccgactgtggtcaagcgcatcaacaactcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
ccaatcgtagcggacgctgaggccggtttcggcggcgtgttgaacgcctacgaactgatg
aagaacatgatcgaagcgggcgccgccggcgtgcacttcgaagaccagctggcctcggtg
aaaaagtgtggccacatgggcggcaaggtcctggtacctacccaggaagccgtgcagaag
ctggttgcagcgcgcctggccgctgacgtatcgggcgtaccgaccatcatcctggcccgc
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtgatcggtgagcgtacccgtgaaggcttctacaaggtccgcgccggcctcgaccaggcc
atcgcccgcggccttgcctacgcgccatacgccgacctgatctggtgcgaaaccgccaag
ccagacctggacgaagcacgccgcttcgccgaagcgatcaagaaggaatacccggaccaa
ctgctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaaattccagcgcgagctgtcggccatgggctacaaacaccagttcatcaccctg
gctggtatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgccgacgccagcaaaggctac
accttcgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
attcagggtggcgcatcctcggtgacggcactgaccggttcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system