KEGG   Pseudomonas putida W619: PputW619_3458Help
Entry
PputW619_3458     CDS       T00675                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppw01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppw00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppw00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppw00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppw00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3806947..3808590)
Genome map
AA seq 547 aa AA seqDB search
MREYGDAVLSFNHAEAAMGLHGSLAALNACVECCDRHVAQGGIALVYEDREGNGRLYTFG
QMQAMAARFASVLRAQGVQAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKAI
EHRLEQSHAKVVVTDRGNRAKLDDLVVCPVPIIVGADEGELDFQRLLDAASADCEPVMRS
GNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIGLQPQDNFWNLADPGWAYGLYY
AVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGKAFSTPVQGR
LRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGLEHPVRAGSAGFAIP
GHRIVVLDEQGAELPAGQPGILAVDREQSPLCWFGGYHGLPTKAFVGKYYLSGDTVELNT
DGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPDPERTELIKAFVVLA
SGVHGSAELEETLRQHVRQRLYAHAYPREIAFVSELPKTPSGKLQRFILRNQEVAKQQAQ
QATPARA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtatggcgacgccgtcctttcattcaatcatgccgaggccgcaatggggctg
cacggcagcctcgcagccctcaatgcctgcgtcgaatgctgtgaccgccatgtggcccaa
ggtggtatcgccctggtctacgaggaccgagagggcaatggcaggctctacacattcggg
cagatgcaagccatggcggcccgctttgccagtgtcctgagggcccaaggcgtgcaggcc
ggtgaccgtgtagcagggctgatgccacgcacccccgagttgctggtgaccatcctcgcc
acctggcgcctgggcgctgtttaccagccgttgttcactgcctttggccccaaagccatc
gagcaccgcctggagcagtcgcatgccaaggtagtggtcaccgaccgtggcaaccgcgcc
aagctggacgatctggtcgtgtgccccgtgccgatcatcgtcggcgctgacgagggtgaa
ctggacttccagcgcctgctcgatgccgcctctgccgattgcgagccagtgatgcgctcg
ggcaacgatcccttcctgctgatgttcacctcgggcaccactggccctgccaaacccttg
gaagtgccgctacgcgcgatcgtcgcgttccagggctatatgcgcgatgccattggcctg
cagccacaagacaacttttggaacctggccgacccagggtgggcctatggcctttactac
gcggtcaccgggccgttgtcgctgggtcacgccaccaccttctacgatggcccgttcagt
gtcgaaagctgcgcgcgggtgatcgacaagctgggcatcaccaacctggcaggttcgccc
accgcatatcgcttgctgatcgccgctggcaaggcgttctcaacgccggtccagggccgc
ctgcgggtcgtcagcagtgccggtgaaccgctcaaccccgaggtgatccgctggttcgcc
gatgagttgggcgtgaccatccatgaccactacgggcagaccgagctgggcatggtgttg
tgcaaccaccacggccttgagcatcccgtgcgggcgggttcggccggttttgccatccct
ggccaccgcatcgtggtgctggacgagcagggcgccgaattgcccgcagggcagcctggc
attctggcagtggatcgggagcagtcgccgctttgctggttcggtggctatcacggcctg
cccaccaaggccttcgtcggcaagtattacctgagcggcgataccgtcgagttgaacacc
gacggcagcatcagcttcgtcggccgcagcgacgacgtgatcaccacctctggctaccgt
gttggtccgttcgatgtggaaagcgcactgatcgagcacccggctgtgatcgaagccgca
gtgattggcaagccggaccctgagcgcaccgaactgatcaaggcctttgtggtgctggct
agcggtgttcacggtagtgccgagctggaagagaccctgcgccagcacgttcgccagcgg
ttgtatgcccacgcctatcccagggaaatcgcattcgtcagcgagctgcccaagaccccg
agcggcaagctgcaacgcttcatcctgcgcaatcaggaagttgccaaacaacaagcgcaa
caggccactcctgcccgcgcctga

DBGET integrated database retrieval system