KEGG   Pseudomonas putida W619: PputW619_3511Help
Entry
PputW619_3511     CDS       T00675                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00020  Citrate cycle (TCA cycle)
ppw00310  Lysine degradation
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01200  Carbon metabolism
Module
ppw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputW619_3511
  Amino acid metabolism
   00310 Lysine degradation
    PputW619_3511
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PputW619_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACA73994
UniProt: B1JAV5
Position
complement(3871211..3872413)
Genome map
AA seq 400 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVMGDIV
KGEGDTVLSDEVLGSIVEGGAAAAAPAAAPAAAAADAGEDDPVAAPAARKLAEENGIDLA
TVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAPVVTAAGDRTEKRVPMTRLRA
KIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFVKAATEA
LKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENGIATFGKK
ARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAINGQVVIR
PMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
accgacaaagtcgttctggaagtactggctaccgccgatggcgtgatgggcgacatcgtc
aagggcgagggcgataccgtcctgtccgacgaagtgctgggttcgatcgtggaaggtggt
gctgctgccgccgcgcctgctgccgctccggccgccgccgccgccgatgctggcgaagac
gacccggttgccgctccggccgcgcgcaagctggctgaagagaacggcatcgacctggct
accgttgccggtaccggcaaaggtggccgcgtcaccaaggaagacgtggttgctgcagtt
gccaacaagaagtccgcacctgccgctgctccggctgccaagcctgccgctgccgcccca
gttgtgaccgccgctggcgatcgcaccgagaagcgtgtgccgatgacccgcctgcgtgcc
aagatcgccgagcgtctggtcgaagcccagtccaacatggcgatgctgaccaccttcaac
gaagtcgacatgaccgaagtgatggccctgcgttcgaagtacaaggacctgttcgagaag
acccacaacggcgtgcgcctgggcttcatgtcgttcttcgtcaaggctgctaccgaagcg
ctgaagcgtttcccggcagtcaacgcttcgatcgacggcaacgacatcgtctaccacggt
tttgccgacgtcggcgttgccgtctccagcgaccgtggcctggtggtgccagtactgcgc
aacgccgaatcgatgagcctggctgaaatcgagaacggcatcgccaccttcggcaagaag
gcccgtgacggcaagctgtcgatcgaagaaatgaccggcggcactttcaccatcaccaac
ggtggtaccttcggctcgatgatgtcgaccccgatcgtcaacccgccgcaggccgccatc
ctcggcatgcacaacatcatccagcgtccgatggccatcaacggccaagtggtaatccgc
ccgatgatgtacctggcgctgtcgtacgatcaccgcctgatcgacggcaaggaagcggta
accttcctggtcaccatcaagaacctgctggaagatccgtcccgcctgctgctggacatc
taa

DBGET integrated database retrieval system