KEGG   Pseudomonas putida W619: PputW619_4023Help
Entry
PputW619_4023     CDS       T00675                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00561  Glycerolipid metabolism
ppw00564  Glycerophospholipid metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PputW619_4023
   00564 Glycerophospholipid metabolism
    PputW619_4023
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     PputW619_4023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_prokar ABC2_membrane_5
Motif
Other DBs
NCBI-ProteinID: ACA74503
UniProt: B1JD95
Position
complement(4448934..4449296)
Genome map
AA seq 120 aa AA seqDB search
MSPFKGQTGLKRIFNAAGYSLDGLRAAFKGEAAFRQLVLLNVLLIPIAFWLPVSRAERAI
MIAVCLLGLIVELFNSAVEAAIDRISLERHPLSKNAKDMGSAAQFVALTMVAAVWGVILL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccattcaaaggccagaccggcctcaaacgtatcttcaacgccgccggctattcg
ctggacggcctgcgcgccgccttcaagggcgaggctgctttccgtcaactggtactgctc
aatgtgctgctgatcccgattgccttttggctgccggtaagccgcgcagagcgggccatc
atgattgccgtgtgcctgctcgggctgatcgtcgaactgttcaactcggcggtggaggcg
gccatcgaccgcatttcgctggagcgccatccgctatcgaaaaacgccaaggacatgggc
agtgctgcgcaattcgtagcactgaccatggtggcggcggtctggggcgttatcctgctc
taa

DBGET integrated database retrieval system