KEGG   Pseudomonas putida W619: PputW619_4125Help
Entry
PputW619_4125     CDS       T00675                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppw  Pseudomonas putida W619
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputW619_4125
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputW619_4125
Two-component system [BR:ppw02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PputW619_4125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4551824..4552837)
Genome map
AA seq 337 aa AA seqDB search
MKIAIVNDMPMAVEALRRALALEPAHEVIWVASNGAEAVRQCAQATPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNISWLIGQQRPSATKTVAAPLRDAAQRRGLVAIGSSAGGPAALEVLLKGLPKAFPA
SIVLVQHVDQVFAAGMAEWLGSACGMPVRLAREGEPPQPGQVLLAGTNHHIRLLHNGQLA
YTAEPINEIYRPSIDVFFESVARYWRGQAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
SSSAVYGMPKAAAAIDAAVEIRPLERIAGRLMEIFAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatcgtcaacgatatgcccatggcggtagaagcgttgcgccgggccctg
gccctggagcctgcgcatgaggtgatctgggtggccagcaatggcgccgaggccgtgcgc
cagtgtgcccaggcaacgcctgacctgattctcatggacctcatcatgccggtgatggat
ggtgtggaggcgacccggcggatcatggccgagacgccgtgtgccatcgtcatcgttacc
gtcgaccgcaagcagaacgtgcatcgcgtgttcgaggccatgggccatggggccctggat
gtggtcgacaccccggcgctcggcgcgggtgatgcgcgggaggcggctgctccgttgcta
cgcaagatcctcaacatcagctggttgatcggccaacagcggcccagcgcgaccaaaacg
gtcgccgcgccgttacgcgatgccgcccagcgccgcggcttggtggcgatcggctcttcg
gccggggggcctgcggccctcgaggtgctcctaaaggggctgcccaaggcgttcccggca
tccatagtgctggtccagcatgttgaccaagtgtttgctgcaggcatggccgagtggctc
ggcagtgcctgtggcatgccggtgcgcctggcccgtgaaggggagccgccgcagcccggg
caggtcctgttggcgggcaccaatcaccatatacgcctgctgcataacggccagttggcc
tacactgccgaacctatcaacgaaatctaccgcccctcgatcgatgtgttcttcgagagt
gtggcgcgctattggcgcgggcaggcggtgggtgtgttgcttacaggcatgggccgcgat
ggtgcccaaggtctgaaactgatgcgccagcaaggcttcctgaccattgctcaggaccag
tccagcagcgcagtctacggaatgcccaaagccgccgcggcaatcgatgcagcggtggaa
atccgtccgctggagcgaatcgccgggcgcctgatggaaatctttgcacaatga

DBGET integrated database retrieval system