KEGG   Pseudomonas putida W619: PputW619_4148Help
Entry
PputW619_4148     CDS       T00675                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PputW619_4148
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputW619_4148
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PputW619_4148
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PputW619_4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4574001..4575410)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVEGSIADADFKKILEETYGEFAHAAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRNERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLVVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGVAIGELMANFKQGGGFSVDQDRWTEARKLFDS
LAVSDEQTCETIAEVFASTGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFGREERCTVLANDLKAVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagcacccgcggccaggcaccggccctgaatttcgaagacgtcctgctg
gctggcctggccagcgatggcggcctgtacgtgccagagaacctcccacgcttcacccag
gaagaaatcgcttcctgggcaggcctgccgtatcacgaactggccttccgtgtgatgcgc
ccgttcgtcgagggcagcattgccgatgccgatttcaagaagatcctggaagagacctac
ggcgagttcgcccacgccgcggtcgctccgctgcgccaactgaacagcaacgagtgggtt
cttgagttgttccacggcccgacgctggccttcaaggacttcgccctgcagctgcttggt
cgtctgcttgatcacgtactggccaagcgcaacgagcgcgtggtgatcattggcgccacc
agtggcgacaccggctctgccgccatcgaaggctgccgtcgctgcgacaacgtcgacatc
ttcatccttcatccgcaccagcgtgtgtcggaagttcagcgccgccagatgaccaccatc
ttcggcgacaacattcacaacatcgccatcgagggcaacttcgatgactgccaggagatg
gtcaaggctagcttcgccgaccagtcgttcctcaaaggcacccgcctggtcgcagtcaac
tcgatcaactgggcgcgaatcatggcccagatcgtctactacttccacgctgccctgcag
ctcggtggcccggcgcgttcggtggcgttctcggtgccgaccggcaactttggcgacatc
ttcgcgggctacctggcacggaacatgggcctgccggtcagccagctggtggttgccacc
aaccgcaacgacatcttgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgcgaccttgtcgccgtcgatggacatcatggtctcgtccaacttcgagcgtttgttg
ttcgacctccatggtcgcaacggtgtggctatcggcgaactgatggccaacttcaagcag
ggcggcggtttcagcgtcgaccaagaccgctggaccgaggcgcgcaagctgttcgactcg
ctggcagtgagcgacgagcagacctgcgagaccatcgccgaggtcttcgccagcacaggt
gaggtgctcgacccgcataccgcgatcggcgtaaaggccgcgcgcgaatgccgtcgcagc
ctggatacccctatggtggtgctgggcactgcgcacccggtcaagttccctgaggccgta
gagaaggcgggcgtcggcaaggcgctggaactacctgcgcacctgagcgacctgttcggc
cgtgaggagcgctgcacggttctggccaacgacctcaaggcagtccaggccttcgtcagc
cagcacggtaatcgcggcaagccgctttaa

DBGET integrated database retrieval system