KEGG   Pseudomonas putida W619: PputW619_4213Help
Entry
PputW619_4213     CDS       T00675                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppw  Pseudomonas putida W619
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputW619_4213 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_4213 (glk)
   00052 Galactose metabolism
    PputW619_4213 (glk)
   00500 Starch and sucrose metabolism
    PputW619_4213 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_4213 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputW619_4213 (glk)
   00524 Butirosin and neomycin biosynthesis
    PputW619_4213 (glk)
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PputW619_4213 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4646644..4647603)
Genome map
AA seq 319 aa AA seqDB search
MTDLLVGDIGGTNARFALWRDNQLHQVKVFATADYTSPEQAIEAYLHGQGIARGGLSAVC
LAVAGPVDGDEFRFTNNHWRLSRSAFCKTLQVEQLLLINDFTAMALGMTRLQEDEVRQVC
PGKADPARPALVIGPGTGLGVGSLLRLGEQHWLALPGEGGHVDLPVGNAREAAIHQQIHG
QIGHVSAETVLSGGGLVRLYQAICALDGDTVRHKTPAEITDAALSGEPRALAVIEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFTELFMRSGFAASFADKGCMSGYFADVPVWLVT
AEFSGLLGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacggacctgctggttggcgacatcggtggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcaccaggtgaaggtcttcgccactgctgactacaccagcccggagcag
gccatcgaagcttacctgcacggccaaggcatcgcccgtggcgggctgtcggcggtgtgc
ctggcggtggccgggccggtcgacggtgatgagtttcgctttaccaacaatcattggcgg
ctgagccgcagcgcattctgcaagacgttgcaggttgaacagttgctgctgatcaatgac
ttcacggcgatggccttgggcatgacccgcctgcaagaggacgaggtgcgccaggtctgc
cccggcaaggccgacccggcgcgacctgcactggtgatcggcccgggtaccggccttggc
gtcggcagcctgctgcgcctgggtgagcagcattggctggcgctgcccggtgagggaggg
catgtcgacttgccggtgggcaatgcccgtgaagcggcgatccatcagcagattcatggg
cagattggccatgtcagcgctgaaaccgtgctcagcggtggtggcctcgtgcgtttgtac
caggctatctgtgcgttggacggtgataccgtacggcacaagacaccagcagaaattacc
gatgccgccctgagtggtgagccacgggcattggcagtgatcgaacagttctgccgcttc
ctggggcgcgtggcaggtaacaatgtactgaccctgggtgcacgcggtggggtttatatt
gttggcggcgtgattccgcggtttaccgaactgttcatgcgtagcgggttcgctgcaagt
tttgccgacaagggctgcatgagcgggtacttcgcggatgtgccggtgtggctggtgacg
gcagagttttctggactgctgggcgccggcgtggcattacagcaggctctggatcattga

DBGET integrated database retrieval system