KEGG   Pseudomonas putida W619: PputW619_4238Help
Entry
PputW619_4238     CDS       T00675                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ppw  Pseudomonas putida W619
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppw00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppw00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ppw03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ppw03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4678078..4678506
Genome map
AA seq 142 aa AA seqDB search
MSKVDFYILPTDSLSARLDFACKLCEKAWRLGHRVYLHCQDAEQRSELDQRLWRFKGEAF
VPHDLAEAHADATVALGLADNAGEHRDLLINLGADVPGFVGQFERVAEIVVEQADIRQSA
RERFRFYREQGYALQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtcgatttctacatcctgcccaccgactcgctgtcggcacggctggatttc
gcctgcaagctgtgcgaaaaggcctggcgcctcggccaccgggtctacctgcattgccag
gacgccgagcagcgcagcgagctggaccaacgcctgtggcgcttcaagggcgaagcgttc
gtaccccacgacctggcggaggcacatgccgacgccacagtggccctgggtctggccgac
aacgccggcgagcatcgggaccttctgataaacctgggcgctgatgtgcccggctttgtc
gggcaattcgagcgggttgccgaaatcgttgtcgagcaagcggatatccgccaatcggcc
cgcgaacgattccgtttctaccgcgaacagggctatgctctgcaagaccaccgcttacag
cgactttga

DBGET integrated database retrieval system