KEGG   Pseudomonas putida W619: PputW619_4251Help
Entry
PputW619_4251     CDS       T00675                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppw  Pseudomonas putida W619
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_4251
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PputW619_4251
Enzymes [BR:ppw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PputW619_4251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4690912..4692177)
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNAALPILAATLLADGPVTVGNLPHLHDITTMIELFGRM
GIEPVIDEKLAVEIDPRTIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAKIEVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFINAMGGNVQGAGTDTITIDGVERLHSASYRVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLKEAGADLTTGEDWIELNMHGKRPKAVNLRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYEMHRMGAHIQVEGNTAIVTGV
PALKGAPVMATDLRASASLVLSALVAEGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgattattactggcggcgctcgccttgacggcgagatccgcatttcgggc
gcgaagaacgcggccctgccgattctggcggcgaccctgctggctgacggcccggtcacc
gtgggcaacctgccacacttgcacgacatcaccaccatgatcgagctgttcggccgcatg
ggcattgagcctgtgatcgacgaaaagctggcggtggaaatcgacccccgtaccatcaag
accctggtcgcgccttacgagctggtcaagaccatgcgcgcctcgatcctggtgcttggt
ccgatggttgctcgtttcggcgaggccgaagtggccctgccaggcggttgcgccattggt
tcgcgaccggtcgacctgcacatccgcggccttgaggccatgggtgcaaagattgaagtc
gaaggcggctatatcaaggccaaggctcctgagggcggcctgcgcggtgcgcacttcttc
ttcgataccgtcagcgtgaccggtaccgaaaacatcatgatggctgctgccctggccaag
ggccgcagcgtgctgcaaaacgccgcacgcgagccagaagtggtcgacctggccaacttc
atcaatgccatgggcggcaacgtgcaaggtgctggtaccgacaccatcaccatcgatggc
gtcgagcgtttgcactcggccagctaccgagtcatgcccgaccgtatcgagaccggtact
tacctggttgccgctgccgtgactggtggccgcgtcaaggtcaaggacaccgacccgacc
atccttgaagccgtgctggaaaagctcaaggaagcgggtgccgacctgaccaccggcgag
gactggatcgagctgaacatgcatggcaaacggccaaaagccgtcaaccttcgtaccgct
ccgtacccggcgttcccgaccgacatgcaggcacagttcatctcgctcaacgccattgcc
gaaggcaccggcgcggtcatcgagacgatcttcgagaaccgcttcatgcacgtgtacgaa
atgcaccgcatgggcgcgcatatccaggtcgagggcaacaccgccatcgtcacgggcgtg
ccggcactcaagggtgcaccggtcatggccactgatctgcgtgcttccgccagcctggtg
ctgtcggcgctggtcgctgaaggcgataccttgatcgaccgcatctaccacatcgaccgt
ggttacgagtgcatcgaagagaaactgcagatgctgggtgcgaagatccgtcgcgtaccg
ggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system