KEGG   Pseudomonas putida W619: PputW619_4413Help
Entry
PputW619_4413     CDS       T00675                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppw  Pseudomonas putida W619
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PputW619_4413
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PputW619_4413
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PputW619_4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4875062..4875544)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLKALNGQDLPLAPFKGQVVLVVNVASKCGLTPQYASLEKLQQQFKGKGFNVL
GLPCNQFAGQEPGSEKEIQEFCSLNYGVSFPLGAKLEVNGPQRHSLYRLLAGEGAEFPGD
ISWNFEKFLVGKDGRVLARFAPRTAPDDPAVVQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgacgttgaaggcgctgaacggccaggacctgcctttggca
ccgttcaagggccaggtagtgctggtggtcaatgtcgcctccaagtgtggcctgacgccg
caatacgcttcgctggaaaagctgcaacagcagttcaagggtaaaggcttcaacgtgctt
ggcctgccctgcaaccagttcgcaggccaagagcccggcagcgagaaggaaatccaggag
ttctgcagcctcaactatggggtgagcttcccgctgggggcgaagctcgaggtcaacggg
ccgcaacgccattcgctgtaccgcctgctggcgggtgagggcgcggagtttcccggcgat
atcagctggaacttcgagaagtttctggtgggcaaggacgggcgggtgctggcgcgcttc
gcgccgcgtacagcgccggatgatccagccgtggtgcaagccatcgagaaagcgttgggc
tga

DBGET integrated database retrieval system