KEGG   Pseudomonas putida W619: PputW619_4413Help
Entry
PputW619_4413     CDS       T00675                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00480  Glutathione metabolism
ppw00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PputW619_4413
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PputW619_4413
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PputW619_4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACA74893
UniProt: B1JEH3
Position
complement(4875062..4875544)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLKALNGQDLPLAPFKGQVVLVVNVASKCGLTPQYASLEKLQQQFKGKGFNVL
GLPCNQFAGQEPGSEKEIQEFCSLNYGVSFPLGAKLEVNGPQRHSLYRLLAGEGAEFPGD
ISWNFEKFLVGKDGRVLARFAPRTAPDDPAVVQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgacgttgaaggcgctgaacggccaggacctgcctttggca
ccgttcaagggccaggtagtgctggtggtcaatgtcgcctccaagtgtggcctgacgccg
caatacgcttcgctggaaaagctgcaacagcagttcaagggtaaaggcttcaacgtgctt
ggcctgccctgcaaccagttcgcaggccaagagcccggcagcgagaaggaaatccaggag
ttctgcagcctcaactatggggtgagcttcccgctgggggcgaagctcgaggtcaacggg
ccgcaacgccattcgctgtaccgcctgctggcgggtgagggcgcggagtttcccggcgat
atcagctggaacttcgagaagtttctggtgggcaaggacgggcgggtgctggcgcgcttc
gcgccgcgtacagcgccggatgatccagccgtggtgcaagccatcgagaaagcgttgggc
tga

DBGET integrated database retrieval system