KEGG   Pseudomonas putida W619: PputW619_4494Help
Entry
PputW619_4494     CDS       T00675                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00330  Arginine and proline metabolism
ppw00332  Carbapenem biosynthesis
ppw01100  Metabolic pathways
ppw01130  Biosynthesis of antibiotics
ppw01230  Biosynthesis of amino acids
Module
ppw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PputW619_4494
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PputW619_4494
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PputW619_4494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACA74974
UniProt: B1JF56
Position
complement(4960811..4961929)
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTARPSAMNELQAAASIGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGLEVARGLANYSALEAQKIIGQSSDAIESLLGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgactggcgccaagcgctgggtcgtgaagatcggtagtgcgctgctc
acggccgatggcaagggcctcgaccgcggtgccatggccgtatgggtcgagcagatggtt
gccctgcgtgaggcgggtgttgagttggtgctggtgtcctccggggccgtggctgccggc
atgagccagcttggctggaccgcacgaccgagcgcgatgaacgagctgcaggctgccgct
tcgatcggccagatgcgcctggtgcaggcgtgggagtcgagctttggcgagcacggcaag
cacaccgcgcagatccttctgacccacgacgatctgtccgaccgcaagcgttatctcaac
gcccgcagcactctgcggacgttggtcgacctgggcgtggtgccggtgatcaacgaaaac
gacaccgtggttaccgacgagatccgcttcggcgacaacgataccctggccgcgttggtg
gcgaacctggtcgaggccgacctgctggtgatcctcaccgaccgtgacggcatgttcgac
gccgacccacgtaacaatccagaggcacagctgatctacgaggcccgtgccgatgacccg
tcgctcgacgccgtagccggcggtaccggcggtgccctgggccgtggcggcatgcagacc
aagttgcgcgccgcgcgcctggcagcccgttccggcgcccataccatcatcatcggtggc
cgtatcgaacgcgtactcgaccgcctcaaggctggcgagcgcctgggtaccctgctgtcg
cctgagcgcggcatgttggcggcgcgcaagcagtggctggctggccacttgcaaacccgc
ggcacgctggtactggacgccggtgcggttcaggccctgcgccaggccaacaagagcctg
ctgccggtaggcgtgaagaccgtacaaggcagcttccgccgtggcgaaatggtggtgtgc
gtaggccccgacggccttgaagtggcgcgcggccttgccaactacagcgcgctggaagca
cagaaaatcattggccaatcgtccgatgccatcgagtccctgcttggctacagtgccgag
ccggagctggtccaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system