KEGG   Pseudomonas putida W619: PputW619_4754Help
Entry
PputW619_4754     CDS       T00675                                 

Gene name
rpsL
Definition
30S ribosomal protein S12
Orthology
K02950  
small subunit ribosomal protein S12
Organism
ppw  Pseudomonas putida W619
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    PputW619_4754 (rpsL)
Ribosome [BR:ppw03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    PputW619_4754 (rpsL)
  Bacteria
    PputW619_4754 (rpsL)
  Archaea
    PputW619_4754 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5234507..5234878)
Genome map
AA seq 123 aa AA seqDB search
MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTK
RPK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatcaaccagctggtacgtcagccgcgtaagcgttcggtcgaaaagtccgac
gttcctgcgctgcagaactgcccgcaacgtcgtggcgtgtgcacccgcgtgtacaccacc
acgccgaaaaaacctaactcggcactgcgtaaagtatgccgtgtgcgtctgaccaacggt
ttcgaggtttcctcgtacatcggcggtgaaggccacaacctgcaagagcacagcgtcgtc
ctgattcgtggcggccgtgtaaaagacttgccaggtgttcgttaccacaccgttcgcggc
tctctggatacttcgggcgtcaaaggccgtaaccagggtcgttcgaagtacggtaccaag
cgtccgaagtaa

DBGET integrated database retrieval system