KEGG   Pseudomonas putida W619: PputW619_4754Help
Entry
PputW619_4754     CDS       T00675                                 

Definition
(GenBank) ribosomal protein S12
  KO
K02950  
small subunit ribosomal protein S12
Organism
ppw  Pseudomonas putida W619
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    PputW619_4754
Ribosome [BR:ppw03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    PputW619_4754
  Bacteria
    PputW619_4754
  Archaea
    PputW619_4754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5234507..5234878)
Genome map
AA seq 123 aa AA seqDB search
MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTK
RPK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatcaaccagctggtacgtcagccgcgtaagcgttcggtcgaaaagtccgac
gttcctgcgctgcagaactgcccgcaacgtcgtggcgtgtgcacccgcgtgtacaccacc
acgccgaaaaaacctaactcggcactgcgtaaagtatgccgtgtgcgtctgaccaacggt
ttcgaggtttcctcgtacatcggcggtgaaggccacaacctgcaagagcacagcgtcgtc
ctgattcgtggcggccgtgtaaaagacttgccaggtgttcgttaccacaccgttcgcggc
tctctggatacttcgggcgtcaaaggccgtaaccagggtcgttcgaagtacggtaccaag
cgtccgaagtaa

DBGET integrated database retrieval system