KEGG   Pseudomonas putida W619: PputW619_4809Help
Entry
PputW619_4809     CDS       T00675                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppw  Pseudomonas putida W619
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5302234..5302743)
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDRHAHLCAGLDALAAILCDMRCSPAFESQAVGIKSGPFINFVVTGK
TDLGLMELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLALPRAEILKNAF
VLWPLALLAPELVHPGEGKSMARLWQEANIDQVLAPVAFEWRGLQLTSV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagcacggtttacctgggcctgggcagcaacatcgatcgccatgcgcacctg
tgcgccgggctcgatgcattggcggcgatcctctgcgacatgcgttgttctccggcgttc
gaaagccaggctgtggggatcaagagcggtccattcatcaatttcgtggtgacgggcaag
acggaccttgggttgatggagctggaccgccggctcaagttcatcgaggccgacaatggc
cgctatgcgcctgaccgcaagggcctgccgctggatatcgatgtgctgatgtatgacgat
ctgcatggcacgttcgatgggctggcgctgcccagggccgagattctgaagaacgcgttc
gtgctatggccgttggcattgctggcgcctgagctggtgcacccgggagagggtaagagc
atggcccggttgtggcaggaggcaaatatcgaccaggtgctggcgccggttgcgtttgaa
tggcgcgggttgcagcttaccagcgtctga

DBGET integrated database retrieval system