KEGG   Pseudomonas putida W619: PputW619_4846Help
Entry
PputW619_4846     CDS       T00675                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppw  Pseudomonas putida W619
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputW619_4846
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_4846
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_4846
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PputW619_4846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5344503..5346680
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKALYDFVNNEAIPGTGVKADAFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAVAYKSFLQDIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKVRGNKVIAFARAFLDEAA
PLAAGSHVDSTAYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AENVSKGGKTFTRTMNPDREYAAPNGGTVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRTGSVYIVKPKMHGPEEVAFAAEIFSRVEDLLGM
PRNTVKVGIMDEERRTTVNLKACIKSAAERVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILTIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISAQLLANWLRHGVVTQEQVLESL
QRMAAVVDKQNAGDALYRPMAPNFDDNVAFQAAVELVIEGAKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggccctgtacgacttcgtc
aacaacgaagcgatccctggaaccggcgtcaaggccgatgcgttctgggccggggcagaa
aagatcatcaacgacctcgccccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcacacgacgccgtagcc
tataaaagcttccttcaggatatcggctatctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaattgcccacatggcaggcccacagctggtcgtgccg
gtgatgaacgcccgctttgccctgaacgccgccaacgcccgctggggttcgctgtacgac
gcactgtacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggtcagggctac
aacaaggtccgtggcaacaaggtcatcgccttcgcccgcgccttcctcgacgaagccgcg
ccgctggctgctggctcgcacgtcgactccaccgcttaccgcatcgaaggcggcaagctg
gtcgttgccctcaagggcggcagcaacagcggcctgcgtgacgacgcccagctgatcggc
ttccatggcgatgccgccgcgccaaccgccgtgctgctcaagcacaatggcctgcacttc
gaaatccaggtcgatgccagcaccccggtcggcagcaccgacgccgccggtgtcaaagac
atcctgatggaatcggcgctgaccaccatcatggactgtgaagactcggtcgctgccgtc
gatgccgacgacaaggtcattgtctaccgcaactggctgggcctgatgaaaggcgacttg
gccgagaacgtcagcaaaggcggcaagaccttcacccgcaccatgaacccggaccgcgag
tacgcagcgcccaatggcggcaccgtgacccttcacggtcgttcgctgctgttcgtgcgc
aacgtgggtcacctgatgaccaacccggcaattctcgacgcccaaggcaacgagattccc
gaaggcatccaggacggtctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaacacccgtaccggtagcgtctacatcgtcaaaccgaagatgcacggc
cctgaagaagtggcgttcgccgccgagatcttcagccgcgtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggagcgccgtaccacggtgaacctc
aaggcttgcatcaagtcggccgccgagcgcgtggtgttcatcaacactggcttcctcgac
cgtaccggcgacgagattcacacctcgatggaggccggcgccgtggtgcgcaaaggcgcc
atgaagaacgagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggtcttgcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgccggacctgatg
gccgccatgctcgagcagaagatcgctcacccgctggccggtgccaacaccgcttgggtt
ccttcgccgaccgccgccaccctgcacgccctgcactaccataaagtcgacgtgcaggcg
cgtcagcgcgagctggccagccgcaccccggcctcggtcgacgacatcctgaccatcccg
ctggcagctgacaccaactggtcggcagaagagatccgcaacgagctggacaacaacgcc
cagggcatcctcggctatgtggttcgctggatcgaccagggcgtgggttgctccaaagtg
ccggacatcaacgatgtgggcctgatggaagaccgcgctaccctgcgtatctcggcccag
ctgctggccaactggctgcgccatggcgtggttacccaggagcaggtgctggaaagcctc
cagcgcatggccgccgtggtcgacaagcagaacgccggtgacgccctgtaccgcccgatg
gcgccgaacttcgacgacaacgtggcattccaggctgcagtggaactggtaatcgagggt
gccaagcaaccgaacggttataccgagccggtactgcaccgtcgccgccgcgagttcaag
gcgcgtaacgggctgtaa

DBGET integrated database retrieval system