KEGG   Pseudomonas putida W619: PputW619_4865Help
Entry
PputW619_4865     CDS       T00675                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00010  Glycolysis / Gluconeogenesis
ppw00020  Citrate cycle (TCA cycle)
ppw00620  Pyruvate metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01200  Carbon metabolism
Module
ppw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_4865
   00020 Citrate cycle (TCA cycle)
    PputW619_4865
   00620 Pyruvate metabolism
    PputW619_4865
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PputW619_4865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 PYNP_C RnfC_N NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACA75341
UniProt: B1JE80
Position
5371554..5373197
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVIKELKVK
LGDRLKEGDELLVLEAEGAAAPEAPAAAPAPAAAPAAAEKPAAEAAPAPAAAPAAASVQD
IHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVKEVIAKLDD
EVGTGDLIIKLEVAGAAPAAAPAPAAAAAPAKAEAAPAAAPAAAAPAAAPAPVATAPAAG
SNAKVHAGPAVRQLAREFGVDLGAVTATGPHGRILKEDVQVYVKSVMQKAKDAPAAAGAT
GGAGIPPIPVVDFSKFGEVEEVAMTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFR
VAQKAVAEKAGVKLTVLPLLLKACAFLLKELPDFNSSLAPSGKAVIRKKYVHIGFAVDTP
DGLLVPVIKNVDQKSLLQLAAEAAALAEKARTKKLSADDMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLGDVLA
DIRTMLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaaatcatcgagctg
ttcgtcaaagtcggtgaccgtatcgaggctgaccagagcctgctgaccctggagtccgac
aaggcctccatggaaattccggcccccaaggccggtgtcatcaaggaactgaaggtcaag
ctgggcgatcgcctgaaagaaggcgacgagttgctggtcctggaagccgagggcgctgcg
gcgcccgaggcgccagccgccgcacctgccccggccgcagctccggctgctgccgaaaag
ccggctgccgaagccgcccctgcgccggctgcagcccctgctgccgccagcgtgcaggac
atccacgtgccggacatcggctcgtcgggcaaggccaagatcatcgaagtgctggtcaag
gtcggcgacaccgtcgaagccgaccagtcgttgattaccctggagtctgacaaggcctcc
atggagatcccttcgcccgccgcaggcgtggtcaaggaagtgatcgccaagctggacgac
gaagttggcaccggtgacctgatcatcaaactggaagtcgccggcgccgccccggctgct
gcgccagcgcctgccgctgctgctgcaccggccaaggctgaggcggctccggccgctgcg
cctgctgccgctgccccagctgctgcccctgcaccggtcgctaccgcaccggctgccggc
agcaacgccaaggttcacgcaggccctgctgttcgccagctggcccgcgagttcggcgta
gacctgggcgcggtcaccgcgaccggtccgcacggccgcattctgaaagaagacgtgcaa
gtctacgtcaagtcggtcatgcagaaggccaaggacgcaccggcagctgctggcgcgacc
ggcggcgccggcatcccgccgatcccggtggtggacttcagcaagttcggtgaagtggaa
gaagtggcaatgacccgcctgatgcaggtcggtgccgccaacctgcaccgcagctggctg
aacgtgccgcacgtaacccagttcgactccgccgacatcaccgagctggaagccttccgc
gttgcacagaaggccgtggccgagaaggctggcgtcaagctgaccgtattgccactgctg
ctcaaggcctgcgccttcctgctcaaggaactgccggacttcaacagctcgctggcgcca
agcggcaaagccgtgatccgcaagaagtacgtgcacatcggcttcgccgtggacaccccg
gacggcctgctggtccctgtgatcaagaacgtcgaccagaaaagcctgctgcaactggct
gccgaagccgcggccctggccgagaaggcacgcaccaagaagctgtcggcagacgacatg
cagggcgcctgcttcaccatctccagcctcggccacattggcggcaccggcttcacgccg
atcgtcaacgcgcccgaagtggcgatcctcggcgtgtccaaggcaaccatgcagcctgtc
tgggatggcaaagccttccagccgaagctgatgttgccgctgtcgctgtcctacgatcac
cgtgtgatcaacggcgcggccgccgcgcgcttcaccaagcgcctgggcgacgtgctggcg
gatatccgcaccatgctgctgtaa

DBGET integrated database retrieval system