KEGG   Pseudomonas putida W619: PputW619_4949Help
Entry
PputW619_4949     CDS       T00675                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppw  Pseudomonas putida W619
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PputW619_4949
Enzymes [BR:ppw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PputW619_4949
Transfer RNA biogenesis [BR:ppw03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PputW619_4949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5469108..5469935)
Genome map
AA seq 275 aa AA seqDB search
MNDQQLMHEVVKLAGLAGQAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLQALAP
QIPVLSEEDCNIPLAERQGWQRWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVS
MPTSGRCYFGGQGLGAWRAEAGGEPQPVQVRNAPPADGRFTVVASRRHSSPQQEALLSGL
GAAVGELELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVLEGAGGEVIGVDGQ
PFRYPPRESLLNPFFLALPAAASWRQALIQLASAM
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccagcaactgatgcatgaagtggtgaaactggccggcttggcagggcaggcg
atcctgccgttctggcgcgccgacgtggcggtgaccaacaaggcggatgattcgccagtg
accgccgccgacctggccgcacaccgggttatcgccgacggcctgcaggcgctggcgccg
cagatccctgtgctgtccgaggaagactgcaatatcccgttggccgagcgccagggctgg
cagcgctggtggctggtcgaccctttggacggtaccaaggagttcatcgcgggtagcgaa
gagttcaccgtcaatatcgcgctgatcgaaaacggcgaagttgtgtttggcgtggtttcg
atgccgaccagcggccgctgctatttcggtggccaaggcctgggcgcctggcgggcagag
gcaggcggcgagccgcaaccggtccaggtccgtaacgcgccacctgccgatggtcgtttc
accgtggtggccagccgtcgccattccagcccacagcaggaagcgttgctgtctgggctc
ggcgctgctgtcggtgagctggagctggccaatatcggcagctcgctcaagttctgcctg
ctggccgaaggcagcgccgactgctacccgcgcctggcgccgacctcgcagtgggacacc
gctgcggcgcaaggcgtgctggaaggggcaggcggcgaagtgatcggcgtggacggccag
ccgttccgctacccgccacgcgaatccctgctcaaccccttcttcctcgccttgcccgca
gctgccagctggcgtcaggcgctaatccagctcgcctcagcgatgtaa

DBGET integrated database retrieval system