KEGG   Pseudomonas putida W619: PputW619_4998Help
Entry
PputW619_4998     CDS       T00675                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppw  Pseudomonas putida W619
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputW619_4998
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputW619_4998
   00310 Lysine degradation
    PputW619_4998
Enzymes [BR:ppw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PputW619_4998
    2.6.1.48  5-aminovalerate transaminase
     PputW619_4998
Amino acid related enzymes [BR:ppw01007]
 Aminotransferase (transaminase)
  Class III
   PputW619_4998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5519663..5520940)
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVESAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVSTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGVS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVIQVFEEEKLLDRSKAVGEHLTAGLRKIQEKHPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVAQVVAKARDKGLILLSCGTYGNVLRILVPLTAEDELLDKGLAIIEEC
FAELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccttgatgcaacgtcgtgtagccgccgtcccacgtggcgta
ggccagattcacccgatcttcgtcgaaagcgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagttctgaacaccggccacctgcac
cccaaagtggttgccgctgttcaagagcagctgaccaaagtcagccacacctgcttccag
gtactggcttacgagccttacgtagagctgtgcgagaagatcaacaagctggtcccaggt
gacttcgacaagaagaccctgctggtttccaccggctccgaagccgttgagaacgccgtg
aaaatcgcccgtgccgccactggccgtgctggtgtaatcgccttcaccggcggctaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggttgtgccgtactccgcaggcatg
ggcctgatgccgggcggcatcttccgcgccctgttcccgagcgaactgcacggtgtcagc
gttgacgatgccatcgcttcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgctgcgatcatcctcgagccggtacagggcgaaggcggcttcctgccagcgcctaaa
gagctgatgaagcgcctgcgcgccctgtgcgaccagcacggcattctgctgatcgccgac
gaagtacagactggtgcgggccggaccggcaccttcttcgccatggaacagatgggcgtc
gcgccggacctgaccaccttcgccaaatccattgctggcggcttcccgctggccggtgtt
tgcggcaaggccgagatcatggacgccatcgctccgggcggcctgggcggtacttacgcc
ggttcgccgatcgcctgtgctgcggctctggccgtcatccaggtgttcgaagaagagaag
ctgctggaccgcagcaaggcagtaggtgagcacctgaccgctggcctgcgcaagatccag
gaaaagcacccgatcattggcgacgtccgtggtctgggctcgatgatcgctgtggaagtc
ttcgaaaaaggcacccacaccccgaacgccgctgcggttgcccaagtggttgccaaagcc
cgtgacaagggcctgatcctgctgtcttgcggcacctacggcaacgttctgcgtatcctg
gttccgctgaccgccgaagatgagctgctcgacaagggcctggccatcatcgaagagtgc
ttcgctgaactggcctga

DBGET integrated database retrieval system