KEGG   Pseudomonas putida W619: PputW619_5099Help
Entry
PputW619_5099     CDS       T00675                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppw  Pseudomonas putida W619
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5657017..5658978)
Genome map
AA seq 653 aa AA seqDB search
MTEEAERWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAEGSDKAVDQCMKEMRE
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVTQLQGLPLSGDVSRSL
KKLAKKLDGGVSQSRELPPLLGELSGLQGRALSSLNRPDEDARPGFLQRLFGNRESEPRG
DNSLEPAAPSAIAAPELQPLPDGPVLVDLPPRDIDELQPLVAPEVHNPVPVVPETPVAAP
PVPGEPEPHAQEPVEVAPVCAEQPQRIEGARTELPIQVDEPQALKPLEETFGEDGPYSLP
DAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAV
LMLAITDSGQHEFETYLQQLNERLESFQSHLHEASAGHADNSSAARELDSQLREQVDGLQ
SSVQGAVDVDSLKHILENRLEGLLVTMDEHQHERDRREQELAGRLQGLAERVANMEQEAL
GYREHLEETRQKALIDPLTGLPNRAAWSEQVEREMQAWQENGGHLAMAILDLDHFKRIND
SYGHLAGDKVLKIVADQLRKRLRPRDFIARFGGEEFVLLLAQTSPTVAAQVAEVLRAAIE
ACPFHFKGERVVITASIGLSAFRSGERDDQVLKRADAALYRAKDLGRNRVEQS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaagccgagcgctggaaagaaaaataccttaaaagcatcgaacagcaggaa
aagctggagcggcgatgggcagcgcggcttgacctgctgcgtcgaggcctggtgcgcagt
accctggccgctgaaggcagcgacaaggcggtggaccaatgcatgaaggaaatgcgtgag
gtcattcgcagcgacaatatggatgccgggcttgccgggttgatcccccgtcttgaaaag
gccgtgctcgactccgagcaacgccgcgaaacccgcatgaaccaggtcagcgatgcgctg
accgcgctcgtgacgcagctgcaaggcctgccgttgtctggtgatgtatcgcgatcgctc
aagaaactggcgaagaaactcgacggcggcgtcagccagtcgcgcgagttgccgccgctg
ctcggagagctgagcgggttgcaggggcgggcgctgtcatcgttgaacaggccggatgag
gatgccaggccgggctttttgcagcgcttgttcggcaaccgcgagagcgaaccgcggggt
gacaactctttagagccggcggccccttctgcaatcgctgcgcctgaactgcagccattg
ccggacggtccggtgctggtggatctaccaccccgggatatcgacgagctgcagccgttg
gtagcacctgaggttcataacccagtgcctgtggtgcctgaaacgcctgttgccgcaccg
cccgttccaggcgagcctgagccgcacgcacaggagccggtcgaggttgcacccgtctgt
gctgagcaaccgcagcgcatcgagggcgctcgaaccgagctgccaatacaggtcgatgag
ccacaagcgctcaagcccctggaagaaaccttcggcgaagacggaccctattcactccct
gatgcagtcgagccgccttacagtcaggttgccgcgcatatcgagcaaaccctgatcggc
ctgctcgatgacctcagcctacccgaacgccacaaagcccaggcactggaaatgcgcgag
cgcgtggcacgggggctgaactggtatgagctgatcccggtgctcgatgacctggccgtg
ctcatgctggcgatcaccgacagcgggcagcacgaattcgagacttacctgcagcagctc
aatgagcgtctcgagagcttccagagccaccttcatgaagccagtgccggtcatgccgac
aacagttctgctgcacgcgagcttgacagccagctgcgtgaacaggtcgatggcctgcaa
agcagcgtgcaaggggcggtcgatgtggacagcctcaagcacattctcgagaaccgcctg
gaagggctgctggtcacaatggatgagcatcagcatgagcgtgaccgccgcgaacaggag
ctggccgggcgccttcagggcttagccgagcgcgtcgcgaacatggagcaggaggccctc
ggctaccgcgaacaccttgaggaaacgcggcagaaggcattgatcgacccgctgaccggg
ctgcccaatcgcgcggcctggagcgagcaggtagagcgcgaaatgcaggcctggcaggag
aacggcggccacttggcgatggcgattctcgacctggaccatttcaagcgcatcaatgac
agctatggccatctggcgggcgacaaggtactgaagatcgtcgctgaccagttgcgcaag
cgcttgcggccgcgcgatttcatcgcccgtttcggtggcgaggagttcgtactgttgctg
gcgcagacgtcacccaccgtagctgcgcaagtggccgaggtgctgcgtgccgcgatcgaa
gcgtgtccgttccatttcaagggcgaacgggtggttatcaccgcctccatcggtttgagc
gcattccgctcgggtgagcgcgatgatcaggtgctaaagcgtgctgatgcggcgctgtac
cgggccaaggacctgggccgtaatcgggtggaacaaagctga

DBGET integrated database retrieval system