KEGG   Pseudomonas putida DOT-T1E: T1E_0149Help
Entry
T1E_0149          CDS       T02181                                 

Gene name
thlA
Definition
(GenBank) beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    T1E_0149 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    T1E_0149 (thlA)
   00640 Propanoate metabolism
    T1E_0149 (thlA)
   00650 Butanoate metabolism
    T1E_0149 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_0149 (thlA)
   00072 Synthesis and degradation of ketone bodies
    T1E_0149 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_0149 (thlA)
   00310 Lysine degradation
    T1E_0149 (thlA)
   00380 Tryptophan metabolism
    T1E_0149 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T1E_0149 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_0149 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    T1E_0149 (thlA)
Enzymes [BR:ppx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T1E_0149 (thlA)
Exosome [BR:ppx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T1E_0149 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
170163..171347
Genome map
AA seq 394 aa AA seqDB search
MSSAEIYVVSAVRSAIGGFGGSLKDLPLADLASAVTRAAIERSGLAAEQVGHLVMGTVIP
TEPRDAYLARVAAMNAGIPKETPAFNVNRLCGSGLQAIVSAAQGLLLGDTDVAVAAGAES
MSRGPYLLPQARWGARMGDLQGIDYTVGVLQDPFQHFHMGITAENVSAKHGITREMQDEL
ALTSQRRAARAIAEGRFASQIAALELKTRKGSVQFSVDEHVRADVTAEQLAGMKPVFKKD
GTVTAGNASGINDGAAGLVLATGDAVRRLGLKPLARLVGYAHAGVEPELMGLGPIPATRK
VLEKTGLNLQDLDVIESNEAFAAQACAVARELGFDPEKVNPNGSGISLGHPVGATGAIIA
TKAIHELQRIQGRYALATMCIGGGQGIAVVFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcagaaatctacgtcgtcagtgccgtccgttcagccattggtggcttcggc
ggttccctcaaggacctgccactggccgacctggccagcgccgtgacccgcgccgccatc
gagcgttcgggcctggccgccgagcaagtcggccacctggtgatgggcacggtgatcccc
accgaaccgcgtgacgcctacctggcacgggtagcggcaatgaacgctggcatccccaag
gaaacgccggcattcaacgtcaaccgcctgtgcgggtctggcctgcaggctattgtctct
gcggcccagggcctgttgctgggcgacaccgatgtggccgtcgcagccggcgccgaatcc
atgagccgtggcccttacctgctgccacaggcgcgctggggtgcacgcatgggtgacctg
caaggcatcgactataccgtcggcgtgctgcaggacccgttccagcacttccacatgggc
atcaccgccgagaacgtttcggccaagcacggcattacccgcgaaatgcaggacgaactg
gccctgaccagccagcgccgtgccgcgcgtgccattgccgagggccgcttcgccagccag
atcgctgcgctggagctgaaaacccgcaaaggcagcgtgcagttcagtgtcgacgagcat
gtgcgtgctgatgtgaccgccgaacaactggccggtatgaagccggtattcaagaaagac
ggcaccgtcaccgccggcaacgccagcggtatcaacgatggcgccgccggcctggtgttg
gccaccggtgacgcggtgcgccgcctgggcctgaaaccgttggcacgcctggtgggctat
gcccacgccggggtggagcccgagctgatgggcctggggccgattccggccacccgcaaa
gtgctggaaaaaaccggcctgaacctacaagacctggatgtgatcgagtccaacgaggcc
ttcgctgcccaggcctgcgccgtggcccgcgagctgggcttcgacccggaaaaggtcaac
cccaacggttcgggcatttccctgggccacccggtgggtgccaccggtgcgatcatcgcc
accaaggccatccatgagctgcagcgcatccagggccgctacgccctggccacgatgtgt
atcggcggtggccaaggcatcgccgtcgtgttcgagcgcgtctga

DBGET integrated database retrieval system