KEGG   Pseudomonas putida DOT-T1E: T1E_0154Help
Entry
T1E_0154          CDS       T02181                                 

Gene name
cheB2
Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    T1E_0154 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    T1E_0154 (cheB2)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     T1E_0154 (cheB2)
Two-component system [BR:ppx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   T1E_0154 (cheB2)
Bacterial motility proteins [BR:ppx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    T1E_0154 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(174494..175069)
Genome map
AA seq 191 aa AA seqDB search
MSGVRAVVVGASAGGVAALFQVLGALPSTFAIPVLCVLHLPDDRHSQLAGVLQRRLHRPV
CEARDKERISGGQIYVAGPGYHLSVERDLTLSLSQEEPVHFSRPAIDFLFISAADAYGDS
LLGVLLTGANEDGARGLAYIKNNGGRTIVQDPRDAQVALMPEAALALHQPDHILTLSGIG
QLLATLEYSAC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgtacgtgcagtggtggtcggcgcctcggccggtggcgtggcggcattgttc
caggtgctcggcgcgctgccatcgacgttcgccataccggtgctctgcgtgctgcacttg
ccggacgaccgccacagccaactggctggcgtgctgcagcggcggctgcatcggccggtg
tgcgaggcacgtgacaaggagaggatcagcggcgggcagatctatgtggcagggccgggt
taccacttgtcggtagagcgcgacctgacgctgtcgctgagccaggaagaaccggtgcat
ttctcgcgcccagcgatcgacttcctgttcatctcggcggccgatgcctatggcgacagc
ctgctgggtgtgctgcttaccggcgccaacgaagacggcgccaggggccttgcctacatc
aagaacaatggggggcgcacgattgtccaggaccctcgtgacgcacaggttgccctgatg
ccggaggccgccctggccctgcaccagcccgaccatattcttactctgagcggtatcggg
cagttgctcgcgaccctggaatacagcgcatgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system