KEGG   Pseudomonas putida DOT-T1E: T1E_0242Help
Entry
T1E_0242          CDS       T02181                                 

Definition
(GenBank) Toluene efflux pump membrane transporter ttgB
  KO
K18138  
multidrug efflux pump
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
beta-Lactam resistance
Cationic antimicrobial peptide (CAMP) resistance
Module
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    T1E_0242
   01503 Cationic antimicrobial peptide (CAMP) resistance
    T1E_0242
Transporters [BR:ppx02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   T1E_0242
Antimicrobial resistance genes [BR:ppx01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    T1E_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(279170..282322)
Genome map
AA seq 1050 aa AA seqDB search
MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYPSIAPPAIAIAVTYPGASAQTVQDT
VVQVIEQQLNGIDNLRYVSSESNSDGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQ
EVQQQGIRVTKAVKNFLLVIGLVSEDGSMTKDDLANYIVSNMQDPISRTAGVGDFQVFGA
QYAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGQLGGLPALPGTQLNATIIGKTRL
QTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAVKLATGANAL
DTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEAVVLVFLVMYLFLQ
NFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVM
SEEGLPPKEATKRSMEQIQGALVGIALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
SVLVALIFTPALCATMLKPLKKGEHHTAKGGFFGWFNRNFDRSVNGYERSVGTILRNKVP
FLLAYALIVVGMIWLFARIPTAFLPEEDQGVLFAQVQTPAGSSAERTQVVVDQMREYLLK
DEADTVSSVFTVNGFNFAGRGQSSGMAFIMLKPWDERSKENSVFALAQRAQQHFFTFRDA
MVFAFAPPAVLELGNATGFDVFLQDRGGVGHAKLMEARNQFLAKAAQSKILSAVRPNGLN
DEPQYQLTIDDERASALGVTIADINNTLSIALGASYVNDFIDRGRVKKVYIQGEPSARMS
PEDLQKWYVRNGAGEMVPFSSFAKGEWTYGSPKLSRYNGVEAMEILGAPAPGYSTGEAMA
EVERIAGELPSGIGFSWTGMSYEEKLSGSQMPALFALSVLFVFLCLAALYESWSIPIAVV
LVVPLGIIGALIATSLRGLSNDVYFLVGLLTTIGLAAKNAILIVEFAKELHEQGRSLYDA
AIEACRMRLRPIIMTSLAFILGVVPLTIASGAGAGSQHAIGTGVIGGMISATVLAIFWVP
LFFVAVSSLFGSKEPEKDVTPENPRYEAGQ
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttctttatcgatcgcccgatcttcgcctgggtgatcgccttggtgatcatg
ctggtcggggccttgtctatcctgaagctgccgatcaaccagtaccccagtatcgcgccg
ccggccatcgccatcgccgtgacctacccgggcgcctcggcgcaaaccgtgcaggacacc
gtggtgcaggtgatcgagcagcagctcaacggtatcgacaacctgcgttatgtgtcgtcg
gaaagtaactccgacggcagcatgaccattaccgccaccttcgaacagggcaccaacccc
gacaccgcgcaggtacaggtacagaacaagctgaacctggccaccccgctgctgccgcag
gaagtgcagcagcaaggtatccgcgtcaccaaagcagtgaagaacttcctgctggtgatt
ggtctggtctccgaagacggcagcatgaccaaggacgacctggccaactacatcgtctcg
aacatgcaggacccgatctcgcgtaccgccggtgtgggtgacttccaggtgttcggtgcg
cagtacgccatgcgtatctggctcgatccggccaagctgaacaagttccagctgaccccg
gtcgacgtcaagaccgctgtggccgcacagaacgtgcaggtgtcttccggccagctcggc
ggcctgccagccctgccgggcacccagctgaacgccaccatcatcggcaagacccgcctg
caaaccgccgagcagttcgagagcattctgctcaaggtcaacaaagacggttcacaggtg
cgcctgggtgacgtcgcccaagtaggcctggggggtgaaaactacgccgtcagcgcccag
ttcaacggcaagccggcttccggcctggcggtaaaactggcaaccggcgccaacgccctg
gacaccgccaaggcactgcgcgagaccatcaaaggcctggaaccgttcttcccgccgggg
gtcaaggcggtattcccgtatgacaccacccccgtggtcaccgaatcgatcagcggcgtg
atccacaccctgatcgaagccgtggtgctggtgttcctggtgatgtacctgttcctgcag
aacttccgcgccaccatcatcaccaccatgaccgtgccggtcgtattgctgggtaccttc
ggtatccttgccgccgcgggcttcagcatcaacaccctgaccatgttcgccatggtcctg
gccatcggcttgctggtggacgacgccatcgtcgtggtggagaacgtcgagcgggtcatg
tccgaagaaggcttgccgcccaaggaagcgaccaagcgctcgatggaacagatccagggc
gccctggtgggtatcgccctggtgctctcggccgtactgctgcccatggcgttctttggc
ggctccacgggtgtgatctaccggcagttctccatcaccatcgtctcggccatgggcctg
tcggtgctggttgcgcttatcttcaccccggcgctctgcgcgaccatgctcaaaccgctg
aagaagggcgagcaccacaccgccaaaggcggcttcttcggctggttcaaccgcaacttc
gaccgcagcgtcaacggctacgagcgtagcgtaggcaccatcctgcgcaacaaggtgcca
ttcctgctggcctatgcgctgatcgtggtcggcatgatctggctgttcgcccgcatccct
accgcgttcctgccagaagaagaccagggcgtactgttcgctcaggtgcagaccccggcc
ggttccagtgccgagcgcacgcaggtcgtggtcgaccagatgcgtgaatacctgctcaag
gacgaagccgataccgtatcgtcggtgttcacggtcaacggtttcaacttcgcaggccgc
ggccagagctcaggcatggccttcatcatgctcaaaccctgggatgaacgctcgaaggag
aacagcgtgttcgccctggcccagcgcgcccagcagcacttcttcaccttccgtgatgcg
atggtgttcgccttcgccccgccagcggtgcttgaactgggtaacgccaccggcttcgac
gtgttccttcaggaccgcggcggtgtcggccacgcgaagttgatggaggcacgcaaccag
ttcctggccaaagctgcgcagagcaagatcctcagcgccgtgcgcccgaacggcctgaac
gatgaaccgcagtaccaactgaccattgatgacgaacgtgccagcgccttgggcgtgacc
attgccgacatcaacaacaccctgtcgattgccttgggtgccagctacgtcaacgacttc
atcgaccgtggccgggtcaagaaggtgtacatccagggcgaacccagcgcgcggatgagc
ccggaagacctgcaaaaatggtacgtgcgcaacggcgcaggcgagatggtgccgttctcc
tccttcgccaaaggcgaatggacctacggttcgccgaagctgtcgcgttacaacggtgtc
gaagcgatggaaatcctcggtgcaccggcgcctggttacagtaccggtgaagccatggcc
gaggtcgagcgcattgcaggcgagctgccgagcggtatcggcttctcctggaccggcatg
tcctacgaggaaaaactctccggctcgcagatgccggcgctgttcgccctctcggtgctg
ttcgtgttcctgtgcctggcggccctgtacgaaagctggtcgattccgatcgctgtggtg
ctggtggtaccgctgggtatcatcggtgcgctgatcgccaccagcctgcgcggcctgtcc
aacgacgtgtacttcctggttggcctgttgaccaccatcggtcttgcggcgaaaaacgcc
attttgatcgtggaattcgccaaggagctgcacgaacaaggccgtagcctgtacgacgca
gcgatcgaagcgtgccgcatgcgtctgcgcccgatcatcatgacctcgctggcgttcatc
ctgggcgtggtgccgttgaccatcgccagcggcgccggcgccggcagccagcacgccatc
ggtactggcgtgatcggcggtatgatcagtgcgaccgtgctggctatcttctgggtacca
ctgttcttcgtcgcagtgtcgtcgctgttcggcagcaaagagccggaaaaagacgtcacc
cctgaaaatccacgttatgaggctgggcaatga

DBGET integrated database retrieval system