KEGG   Pseudomonas putida DOT-T1E: T1E_0397Help
Entry
T1E_0397          CDS       T02181                                 

Gene name
yhjM
Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     T1E_0397 (yhjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(449604..450719)
Genome map
AA seq 371 aa AA seqDB search
MMRQMLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSY
ALFFALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADL
WIAYSLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLN
PSYLPLQLLDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNA
GDYDAIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPAG
FSAALLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGR
LLPAWSAPCSE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtcagatgctggtagggctggtcgccttaggcctgcccgtcttcgccaatgcc
gggtcggtttgcccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggat
gggcgggtcatcgacccgagtgacgagcgcctgatcaccacctcggaagggcagagttac
gcgttgttcttcgccctggtaggtaacgaccggcaaaccttcgcgcagttgctgcgttgg
accagcaacaacctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggc
cgtgacgggcagcagcagtggcaggtgctggacgccaacaacgctagcgatgccgatctg
tggatcgcctacagcctgctggaagcagggcggttgtgggaccagccggcctacacgcaa
ctgggccagcacctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggcctt
ggcgtgatgttgctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaac
cccagctacctgccgctgcagctgctcgaccgcttcagcgaggtggaccccttgtggggt
gagctggcggccaacacgcggcgtttgtggttggcatcgtcgccaaagggctttgcaccg
gactggttgctgtggacgccggccggaaagccagcggcagacacgaaacatggcaatgcc
ggtgattatgacgccattcgtgtgtacctgtgggtcggcatgttggccgagggggcggcg
caacgccgcgaactggtcgcccattatgcgccgatggcggcattgacccagcgccagggg
ctacctcctgagcacctggatgcacgcagcggtgaagcccgcggccatggcccggcaggt
ttctctgcggccttgctgccattgcttgctgcctcgccagagcacgtggccggcctggcg
gcccagcgccagcgcttgcgcgaacaaccggtcgaggccaaggcgtattacagccaggtg
ctggcgctgttcggccagggcttcgacgaggcccgttaccgttttgacccgcacggccgc
ctgttgccggcctggagtgcgccatgcagcgaatga

DBGET integrated database retrieval system