KEGG   Pseudomonas putida DOT-T1E: T1E_0428Help
Entry
T1E_0428          CDS       T02181                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00020  Citrate cycle (TCA cycle)
ppx00310  Lysine degradation
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
Module
ppx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T1E_0428 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    T1E_0428 (sucB)
Enzymes [BR:ppx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     T1E_0428 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFO46287
UniProt: I7BQA4
Position
complement(487623..488846)
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAASADAGEDDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAAPVVVAAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggcgactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaattgctgggttcgatcgttgaaggcggt
gctgccgccgcgcctgccgcggccgccgcaccagcagcggctccggccgctgccagcgct
gacgccggcgaagatgacccgatcgctgccccggctgcgcgcaagctggctgaagaaaac
ggcatcgacctggctactgtggcaggcaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaacaagaagtcggcacctgccgctgcaccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtcgccgctggcgaccgtaccgagaagcgtgtg
ccaatgacccgcctgcgtgccaagatcgccgagcgcctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcgcctgggcttcatgtcgttcttc
gtcaaggctgctaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggcaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggccgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtcgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tcccgcctgctgctggacatctaa

DBGET integrated database retrieval system