KEGG   Pseudomonas putida DOT-T1E: T1E_0469Help
Entry
T1E_0469          CDS       T02181                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    T1E_0469 (hemB)
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     T1E_0469 (hemB)
Exosome [BR:ppx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T1E_0469 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(533313..534287)
Genome map
AA seq 324 aa AA seqDB search
MSNQFPSVRPRRLRQNESLRTIFQETEFRLEDLILPIFVEEGIDDFVPITSMPGVNRIPE
KLLAQEIERYARAGIKSVMTFGVSHHLDADGSDTWNENGLVARMSRICKDTVPEMVVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRSA
LDGAGFHDTAIMAYSTKFASSLYGPFREAGGTALKGDRKSYQMNPMNRREAVRESLLDEQ
EGADVLMVKPAGAYLDVIADIRAASRLPLAAYQVSGEYAMIKFGGLAGAIDEGRVVRESI
GAIKRAGADLILTYFAMDLARDGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccaattcccgtccgttcgtccccgccgcctgcgccagaacgagtccctgcgc
acgatcttccaggaaaccgagttccgccttgaagacctgatcctgccgattttcgtcgaa
gagggcatcgatgatttcgtgccgatcaccagcatgcccggtgtcaatcgtatccccgag
aagctgttggcccaggaaatcgagcgctatgcccgcgccggtatcaagtcggtgatgacc
tttggcgtatcgcaccacctggatgccgatggcagcgacacctggaacgaaaacggcctg
gttgcgcgcatgtcgcgtatctgcaaggacaccgtgccggaaatggtggtgatgtccgac
acctgcttctgcgaatacaccagccacggccactgcggcgtgctgcatgaccatggcgtg
gacaacgacgccaccctggccaacctgggcaagcaggccgtcatcgccgctgctgccggt
gccgacttcattgccccctcggcggcgatggacggccaggtgcaagctatccgcagcgcg
ctggacggtgccggtttccacgacaccgcgatcatggcctactcgaccaagttcgcctcg
tcgttgtatggcccgttccgtgaggccggcggcactgcactgaagggtgaccgcaaaagt
taccagatgaacccgatgaaccgccgcgaagcggtgcgcgagtcgctgctcgacgagcag
gaaggcgcggacgtgctgatggtcaagccggccggtgcctaccttgatgtgatcgccgac
atccgcgccgcttcgcgcctgccactggcggcgtaccaggtgagtggcgagtatgcgatg
atcaagttcggtggcctggccggtgccatcgacgaaggccgggtggtgcgcgaaagcatt
ggcgcaatcaagcgtgccggtgccgacctgatcctgacctacttcgccatggacctggcg
cgcgacggtatctga

DBGET integrated database retrieval system