KEGG   Pseudomonas putida DOT-T1E: T1E_0546Help
Entry
T1E_0546          CDS       T02181                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00071  Fatty acid degradation
ppx00280  Valine, leucine and isoleucine degradation
ppx00281  Geraniol degradation
ppx00310  Lysine degradation
ppx00360  Phenylalanine metabolism
ppx00362  Benzoate degradation
ppx00380  Tryptophan metabolism
ppx00410  beta-Alanine metabolism
ppx00627  Aminobenzoate degradation
ppx00640  Propanoate metabolism
ppx00650  Butanoate metabolism
ppx00903  Limonene and pinene degradation
ppx00930  Caprolactam degradation
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01212  Fatty acid metabolism
Module
ppx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T1E_0546
   00650 Butanoate metabolism
    T1E_0546
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_0546
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_0546
   00310 Lysine degradation
    T1E_0546
   00360 Phenylalanine metabolism
    T1E_0546
   00380 Tryptophan metabolism
    T1E_0546
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T1E_0546
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    T1E_0546
   00281 Geraniol degradation
    T1E_0546
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_0546
   00627 Aminobenzoate degradation
    T1E_0546
   00930 Caprolactam degradation
    T1E_0546
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     T1E_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AFO46404
UniProt: I7C3X9
Position
complement(619085..619858)
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggtcggcctgatcaccctcaac
cgcccgcaggcgctcaatgcgctgaacgcgcagattgtcggtgagatcaaccaggccttg
gaccagcttgagcgcgacccgaacatcggctgcgtggtgctgacaggctcggccaaagcc
tttgccgctggcgccgacatcaaggaaatggctgagctgcaatacccgcagatctacgtc
gacgacctgttcagcgacgccgaccgcattgccaatcgccgtaagccgatcattgctgca
gtgtctggatttgccctgggcggcggctgtgagttggcgatgatgtgcgactttatcctc
gcggcggacaatgccaaatttggtcaaccggaaatcaacctgggcgtgctgccgggcatg
ggcggtacccagcgcctgacgcgtgcggtgggcaaggccaaggccatggagctttgcctg
accggccgcctgatgggcgcggaagaagccgagcgtgcaggtttggtggcgcggatcgtg
ccgcaggcagagctggtggaagaggcgctgaaggtggcggcgaccattgccagcaagtcg
attccggtgagcatgatggtcaaggagagcgtcaaccgagcatttgaagtcaccctcagc
gagggggttcgttttgagcgtcgtgtcttccatgcggcgttctccaccgaagaccagaaa
gaaggcatggctgcattcatcgccaagcgagaggcacagttcaaggaccgttga

DBGET integrated database retrieval system