KEGG   Pseudomonas putida DOT-T1E: T1E_0604Help
Entry
T1E_0604          CDS       T02181                                 

Gene name
fadB
Definition
Fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    T1E_0604 (fadB)
   01212 Fatty acid metabolism
    T1E_0604 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T1E_0604 (fadB)
   00650 Butanoate metabolism
    T1E_0604 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_0604 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    T1E_0604 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_0604 (fadB)
   00310 Lysine degradation
    T1E_0604 (fadB)
   00380 Tryptophan metabolism
    T1E_0604 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T1E_0604 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    T1E_0604 (fadB)
   00281 Geraniol degradation
    T1E_0604 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    T1E_0604 (fadB)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     T1E_0604 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     T1E_0604 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     T1E_0604 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     T1E_0604 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
682634..684781
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIQADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLLAGALDLIKRAIGGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVFDATVLDVLKPIVFEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgccttaccctgaacgagctg
cgccaggccgtcgatgccatccaggccgatgcctcggtcaaaggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cctgaggccgaactggtcgccggcaacctggaagccaatcgtatcttcaacgccttcgaa
gacctcgaagtgccgaccgttgccgccatcaacggcatcgcgctgggcggcggcctggaa
atgtgcctggcggccgactaccgggtcatgtccaccagcgccaggatcggcctgccggaa
gtcaagctgggtatctacccgggctttggcggtaccgtgcgcctgccgcgcctgatcggc
tcggacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaagacgccctg
aaagtgggggccgtcgacgcggtggtcgcccctgagctgctgctggccggtgccctcgac
ctgatcaagcgtgccatcggtggcgagctggactacaaggccaagcgccagccgaagctg
gaaaagctcaagctcaatgccatcgagcagatgatggccttcgagacggccaagggcttc
gtcgctggccaggccggcccgaactacccggccccggtcgaagcgatcaagagcatccag
aaagccgccaacttcggtcgcgacaaggccctggaagttgaagccgcaggctttgccaag
ctggccaagacctcggtcgccgagagcctgatcggcttgttcctcaacgatcaggaactc
aagcgcaaggccaaggcgcatgacgagatcgcccacgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggcggcggtatcgcctaccagtcggcggtcaaaggtacgccgatc
ctgatgaaagacatccgcgaagaagccattcagctgggtctgaacgaggcctccaagttg
cttggcaaccgcgtcgagaagggccgcctgaccccagccaagatggccgaggccctcaac
gccattcgaccgaccctgtcctatggcgattttgccaatgtcgacatcgtcgtcgaggca
gtggtcgagaacccgaaggtcaagcaagcggtactggcggaagtggaaggccaggtgaag
gacgatgcgatcctcgcttccaacacctctaccatctctatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggtgagaagtccagtgaagtggcggtcgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtactttggcggttttgccaagctggtcagcgccggtgtcgac
ttcgtgcgcatcgacaaggtcatggagaagttcggctggccgatgggcccagcctacttg
atggacgtggtcggcatcgacaccggccaccacggccgtgacgtcatggccgaaggcttc
ccggatcgcatgaaggacgagcgccgctcggcagtcgacgcgttgtacgaggccaaccgc
ctgggccagaagaacggtaagggcttctacgcctacgaaaccgacaagcgcggcaagccg
aagaaggttttcgatgccaccgtgctcgacgtgctcaaaccgatcgtgttcgagcagcgt
gaagtcactgacgaagacatcatcaactggatgatggtcccgctgtgcctggagaccgtg
cgttgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggcctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgttacatcgactcgatcggtgtg
gccgaattcgtcgccctggccgatcagtatgccgacctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system