KEGG   Pseudomonas putida DOT-T1E: T1E_0624Help
Entry
T1E_0624          CDS       T02181                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    T1E_0624 (folK)
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     T1E_0624 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704123..704602
Genome map
AA seq 159 aa AA seqDB search
MTIRAYVGLGSNLDAPAEQLRSALQALDQVEATRLVAASALYTSDSLLPGQPRYTNAVAA
LDTTLAPLALLDALQAIENDQGRVRKERWGPRTLDLDILLFGDQVLDQPRLKVPHYHMHA
RPFVLYPLAELVPGDFRLADGRALAQLLDECPFVGLERL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattcgcgcctacgtaggtctgggcagcaacctggacgcacctgccgagcagttg
cgtagcgccttgcaggcgctggaccaggtcgaagccacgcgcctggtagccgcctcggcc
ctgtacaccagtgattcgctgctgcccggccaaccgcgctacaccaacgctgtcgccgcc
ctggacaccaccctggcgccactggcattgctcgatgcgttgcaggccatcgaaaacgac
cagggccgcgtgcgcaaggaacgctggggcccacgtacgctggacctggacatcttactg
ttcggtgaccaggtgctcgaccagccacgcctgaaagtgccgcattaccacatgcatgcc
cgccccttcgtgctgtatccgttggccgagctggtaccgggcgatttccgcctggccgat
ggtcgtgccctcgcgcaactgctcgacgaatgcccattcgtcggcctggaacgcctgtag

DBGET integrated database retrieval system